SecReT6
Protein ID: 407470883
SecReT6 ID703
T6SS typei4b
Gene symbol-
Locus tagO3O_21230
StrainEscherichia coli O104:H4 str. 2009EL-2071
Repliconchromosome [GenBank: NC_018661] [Browse all T6SS(s) in this replicon]
Location [Strand]891374..892786 [+]
Producthypothetical protein
NoteTssK
UniProt IDK0BNE3
KEGG IDeso:O3O_21230
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 3.30E-64, Aligned region: 20..446
Protein Sequence: 470 a.a.     [Download]
>gi|407470883|ref|YP_006782674.1| hypothetical protein O3O_21230 [Escherichia coli O104:H4 str. 2009EL-2071]
MQEEEQLVYWYSGLYLQPQHFQSIDLHHGFMLARSRQLSQPHHQGYYECCINDDLLKEDTVRVEKIKAVL
SSGYYIEYPGNCVVQDKCLTNLKGSDHGTVDLWLALKRFNSGHKNVSSVNDKRGSARWISSDDERNMRNV
YHDSQDADITRIKYDIQILTDEEKDNTTDYEYLPLTRIIYGNNSLCIDDECSFPVMRLSANHKLRNKIAE
IYSDIKFYKNRLEKYRYTERTVSDGHLYNFLILCAINRTLPLLSSFINEDAIHPWLYYMALCQFAGEIST
FHNSGLSDTRIVELSYNHYEQISCFSDLQYYIKLILDDSCRDKIISVEFRKITTDTLICNFDEYGAGSNS
DYYIKLTSDTFRKNKLIALPEIKIAPSEHIDMIIQHALPGIKFTVMDAVTSDLQVRENTIWLKIDKHSEL
WTLAQTQKRVAFYWSCSPDDLLVELVLSQEKYAVSRPKQDNGSFHPAVGR
 
Nucleotide Sequence: 1413 bp     [Download]
>gi|407466711|ref|NC_018661.1|:891374-892786 Escherichia coli O104:H4 str. 2009EL-2071 chromosome, complete genome
ATGCAAGAAGAAGAACAACTTGTTTATTGGTATTCAGGGCTCTATTTACAACCTCAGCACTTTCAGTCAA
TTGACTTGCATCATGGCTTCATGCTTGCCAGAAGCAGGCAGTTATCACAACCCCATCATCAGGGGTACTA
TGAATGTTGTATCAATGATGATCTTCTTAAGGAAGATACTGTCAGAGTTGAAAAAATAAAGGCTGTTTTA
TCTTCAGGGTATTATATCGAGTATCCGGGTAACTGTGTGGTACAGGATAAGTGCCTGACAAATCTCAAAG
GTTCAGATCACGGTACCGTGGATTTGTGGCTTGCGCTTAAGAGATTCAATTCCGGTCATAAAAATGTCTC
CAGTGTTAATGATAAACGAGGCTCTGCCAGATGGATAAGTTCAGATGATGAACGTAACATGCGTAATGTT
TATCATGACAGTCAGGATGCCGATATTACAAGAATAAAATATGATATTCAGATTCTTACAGATGAGGAAA
AAGATAATACTACAGACTATGAGTATTTACCCCTGACAAGGATCATATATGGAAATAATTCATTATGTAT
TGATGATGAGTGTTCATTTCCCGTGATGAGGTTATCTGCGAATCACAAACTTAGAAATAAGATCGCAGAG
ATCTATTCGGATATTAAGTTCTACAAAAATAGACTGGAGAAATACAGATATACAGAACGAACAGTGTCCG
ATGGACATCTTTATAACTTTTTAATTCTATGTGCTATTAATAGGACATTACCACTTCTTTCTTCATTCAT
TAATGAAGATGCCATTCACCCATGGTTGTATTATATGGCATTATGTCAGTTTGCAGGGGAAATATCTACA
TTTCATAACTCTGGACTTTCAGATACTAGGATTGTCGAACTATCATACAATCATTATGAGCAGATCTCAT
GTTTCAGTGATCTGCAGTATTATATTAAGTTAATACTGGATGATTCATGTCGAGATAAGATTATTAGTGT
TGAATTCAGAAAAATAACTACTGATACATTGATCTGTAATTTCGATGAGTACGGTGCCGGAAGTAATTCA
GATTACTATATTAAGTTAACCTCAGATACCTTCAGAAAGAATAAGCTGATTGCATTGCCAGAGATTAAGA
TTGCTCCATCTGAACATATCGACATGATAATTCAGCATGCTCTTCCAGGAATCAAGTTTACAGTGATGGA
TGCCGTTACATCTGATTTGCAGGTAAGAGAGAATACAATCTGGTTAAAGATAGATAAACATTCAGAATTA
TGGACGTTAGCTCAGACTCAAAAAAGAGTTGCATTCTATTGGTCATGTAGTCCTGATGATTTACTTGTAG
AGTTAGTATTATCGCAGGAAAAGTATGCCGTAAGCAGGCCTAAACAGGATAACGGTTCTTTCCATCCGGC
GGTTGGCAGATAA