SecReT6
Protein ID: 407470884
SecReT6 ID703
T6SS typei4b
Gene symbol-
Locus tagO3O_21235
StrainEscherichia coli O104:H4 str. 2009EL-2071
Repliconchromosome [GenBank: NC_018661] [Browse all T6SS(s) in this replicon]
Location [Strand]890804..891355 [+]
Producthypothetical protein
NoteTssJ
UniProt IDK0BRF9
KEGG IDeso:O3O_21235
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 5.10E-18, Aligned region: 15..152
Protein Sequence: 183 a.a.     [Download]
>gi|407470884|ref|YP_006782673.1| hypothetical protein O3O_21235 [Escherichia coli O104:H4 str. 2009EL-2071]
MTIKCLLLAVMVFPFFITACSDKYSEQDRVQAINNADAPFGAGLLTFQISSDTQLNSLNEISNSCALLFL
QASDKNTLQDIMNNPVLIKQFFIGTGKVDGILKVDKYVAMPGQEITLHIDRNEGTKYVGVIAGYYPFPGK
QHMLLLDIPVDVVEEGWWNKSLHASLLPLSKKISMGKESISMK
 
Nucleotide Sequence: 552 bp     [Download]
>gi|407466711|ref|NC_018661.1|:890804-891355 Escherichia coli O104:H4 str. 2009EL-2071 chromosome, complete genome
ATGACTATTAAGTGCCTGCTACTAGCGGTTATGGTATTCCCCTTTTTCATCACTGCCTGTTCTGATAAGT
ATTCTGAACAGGATAGAGTGCAGGCTATCAACAATGCCGATGCTCCATTTGGCGCCGGCTTGCTTACTTT
TCAGATATCATCTGATACGCAATTAAACTCACTTAACGAGATATCCAACAGCTGTGCATTATTATTCTTA
CAGGCTTCAGATAAAAATACATTACAGGACATAATGAATAATCCTGTGTTAATCAAACAGTTTTTTATCG
GGACAGGTAAGGTTGATGGCATTCTTAAAGTTGATAAATACGTGGCTATGCCGGGGCAGGAGATAACGCT
ACATATAGACAGGAATGAAGGGACTAAATATGTAGGTGTGATTGCTGGATACTATCCATTTCCTGGAAAA
CAGCATATGTTACTCTTAGATATTCCGGTTGATGTTGTTGAGGAAGGTTGGTGGAACAAATCATTACATG
CATCACTCTTACCTCTTTCCAAAAAGATATCGATGGGTAAAGAAAGTATCAGTATGAAATAA