SecReT6
Protein ID: 407470885
SecReT6 ID703
T6SS typei4b
Gene symbol-
Locus tagO3O_21240
StrainEscherichia coli O104:H4 str. 2009EL-2071
Repliconchromosome [GenBank: NC_018661] [Browse all T6SS(s) in this replicon]
Location [Strand]889720..890796 [+]
Producthypothetical protein
NoteTssA
UniProt IDK0BT26
KEGG IDeso:O3O_21240
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 3.40E-22, Aligned region: 57..117
Protein Sequence: 358 a.a.     [Download]
>gi|407470885|ref|YP_006782672.1| hypothetical protein O3O_21240 [Escherichia coli O104:H4 str. 2009EL-2071]
MNKIETDTLLLPVIGESPAGDDIEYDPVYSEIREARQNDPDYMSQGEWAVSEPRRADWRKVRKLCEVTLR
NKSKDLQISCWYVESLTHLYALEGMHCGLEYLAKFISQYWTTCWPSQEEGQEIRYSKLVRLDIDLSEYLK
AYPLLEDKEITLSEWYKVLSFEHGASLSEAGKERLIESEGDHSVESFKRAVGKYNPRKVSEQLLQLYDLP
DKIDEIESSYFFHTHEDIHHIFAKTRHIISEITELLSRFLPQETLDHSSVSQFLGKPDSRDTRTALPEEK
KEFYSALTPSTDKEMSREKAIEQLEKIAIFFRQSEPTSPVPYLLERAIRWSTMTMSEWLEELLKDNDSME
QINRVLKG
 
Nucleotide Sequence: 1077 bp     [Download]
>gi|407466711|ref|NC_018661.1|:889720-890796 Escherichia coli O104:H4 str. 2009EL-2071 chromosome, complete genome
ATGAACAAAATAGAAACGGATACATTACTGCTTCCTGTTATAGGAGAATCGCCGGCAGGTGATGATATTG
AGTATGATCCGGTGTATAGCGAAATACGGGAGGCAAGACAAAATGATCCGGACTATATGTCTCAGGGGGA
ATGGGCTGTCAGTGAACCCCGCAGAGCTGACTGGAGAAAAGTAAGAAAATTATGTGAGGTTACTTTACGT
AATAAGAGTAAGGACCTACAAATTAGTTGCTGGTATGTGGAGTCCTTGACGCATTTATATGCTCTGGAAG
GGATGCATTGCGGATTGGAATATCTTGCAAAGTTTATTTCTCAGTACTGGACTACATGCTGGCCATCGCA
GGAAGAAGGTCAGGAAATTCGTTACAGTAAATTGGTTCGTCTTGATATAGATTTATCAGAGTATCTGAAA
GCATATCCTCTTCTTGAGGATAAGGAAATCACACTTTCTGAATGGTATAAGGTGTTATCGTTTGAACATG
GAGCAAGTTTGTCAGAAGCTGGAAAAGAAAGATTAATAGAGAGCGAAGGTGATCACTCTGTTGAGTCCTT
CAAAAGAGCTGTAGGAAAATATAATCCCCGCAAGGTTAGTGAGCAACTTCTCCAGCTTTATGATCTACCT
GACAAAATTGATGAGATTGAATCTTCTTACTTCTTTCATACGCATGAAGATATACATCATATTTTCGCAA
AAACCAGACATATCATCAGTGAGATAACCGAGTTACTGAGTCGTTTTTTGCCGCAAGAAACACTGGATCA
CAGTTCAGTTTCTCAATTTCTAGGCAAACCCGATAGCAGAGACACAAGGACAGCACTTCCTGAGGAAAAA
AAGGAATTTTATTCTGCATTAACACCCTCAACAGATAAAGAGATGTCAAGGGAGAAAGCTATAGAGCAAC
TGGAGAAAATAGCTATTTTTTTCAGGCAATCTGAACCAACCAGTCCTGTTCCTTATCTTCTGGAGAGGGC
CATACGTTGGTCAACAATGACTATGTCAGAATGGCTTGAGGAACTACTTAAAGATAATGACTCTATGGAA
CAAATAAACCGTGTCTTAAAAGGATGA