SecReT6
Protein ID: 407470886
SecReT6 ID703
T6SS typei4b
Gene symbol-
Locus tagO3O_21245
StrainEscherichia coli O104:H4 str. 2009EL-2071
Repliconchromosome [GenBank: NC_018661] [Browse all T6SS(s) in this replicon]
Location [Strand]889411..889716 [+]
Producthypothetical protein
NotePAAR
UniProt IDK0BTU2
KEGG IDeso:O3O_21245
PDB IDNA
Domain hit(s) vs Pfam PAAR_motif [PF05488], Evalue: 2.00E-20, Aligned region: 3..19
PAAR_motif [PF05488], Evalue: 2.00E-20, Aligned region: 26..94
DUF4150 [PF13665], Evalue: 2.20E-05, Aligned region: 36..53
DUF4150 [PF13665], Evalue: 2.20E-05, Aligned region: 59..87
Protein Sequence: 101 a.a.     [Download]
>gi|407470886|ref|YP_006782671.1| hypothetical protein O3O_21245 [Escherichia coli O104:H4 str. 2009EL-2071]
MYMPQPAARVTDMHVCPMVTPGLPPVPHVGGPLLPPGSPSVFIGGLPAATLGTLALCSGPVDVVIMGSVK
VLICGKPAARMGDICAHGGTIVSGYPQVLIG
 
Nucleotide Sequence: 306 bp     [Download]
>gi|407466711|ref|NC_018661.1|:889411-889716 Escherichia coli O104:H4 str. 2009EL-2071 chromosome, complete genome
TTGTATATGCCTCAACCTGCTGCAAGAGTTACTGATATGCATGTATGTCCTATGGTGACGCCTGGTTTAC
CACCTGTTCCCCATGTTGGGGGGCCATTGTTACCACCAGGCTCTCCGTCTGTATTTATTGGTGGATTACC
GGCAGCGACATTGGGGACCCTGGCTCTTTGTTCTGGGCCAGTGGATGTTGTCATTATGGGAAGTGTTAAG
GTCTTGATATGCGGCAAACCAGCTGCACGAATGGGCGATATCTGTGCTCACGGAGGGACAATTGTCAGTG
GATATCCTCAGGTATTAATAGGATGA