SecReT6
Protein ID: 407470888
SecReT6 ID703
T6SS typei4b
Gene symbol-
Locus tagO3O_21255
StrainEscherichia coli O104:H4 str. 2009EL-2071
Repliconchromosome [GenBank: NC_018661] [Browse all T6SS(s) in this replicon]
Location [Strand]886947..888929 [+]
Producthypothetical protein
NoteTssI
UniProt IDK0BNE6
KEGG IDeso:O3O_21255
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 1.70E-36, Aligned region: 38..318
Phage_base_V [PF04717], Evalue: 1.70E-21, Aligned region: 367..459
Phage_base_V [PF04717], Evalue: 1.70E-21, Aligned region: 463..481
DUF2345 [PF10106], Evalue: 0.00028, Aligned region: 495..630
Protein Sequence: 660 a.a.     [Download]
>gi|407470888|ref|YP_006782669.1| hypothetical protein O3O_21255 [Escherichia coli O104:H4 str. 2009EL-2071]
MTRQRFISDDHYKFQSEHFIRLHGCDISLFPLEIKGKESISDVYSYEIKCFSRTDHNSLDKLHGTRLSCE
IGEQYNSLPARFIHGVVTKVIYNYDNSMQHTCIIILQPEIAELASGKRTRVWSNIKPSDIVSTILEDSLF
SPPQVILYKEQNLLEYKIQYQESDLDFINRILSEAGIYYFFVHNRDKHIMTLADDPASHPKASYDKLEHL
PCENLKESRHGYIREWSFTESLKCPSVTLSGYNESNVSEITIKSESKLTDVKPSKGVYEDIIPERKRELI
KKRSEALIASCDSELKIWSGKTDSWWLSCGECFSLDKQDYRITSLYLNAVNNDNEHAGLCYCDLCASDNK
SSLNFSREFKTPIIPGVLLARVVGPDSEEYYTDDNGRVKISFLWGEKSAAGTDKTSCWVRVSQVWSGEGF
GSQFIPRIGSEVLVSFIQGNPDYPVIVGTVYNGQNTSPFSLPENNCKSGFITRSVKNGKKGEGHQLVFDD
KEGEEKVIVTSSGDSLLTVKKDMISTINRSMSLTIAEGRNAEIKRGNDRLVLKEGDLHNDVHGNINIKVS
NGDYNLKVSGGSGSLITDKNLTLESTQSIKIKVGANEITISTSGIDIKAAKITIEGQVSAEVKAATLKFE
SQAISEVKGTMLTLQGSAMTQIKGGIVNIG
 
Nucleotide Sequence: 1983 bp     [Download]
>gi|407466711|ref|NC_018661.1|:886947-888929 Escherichia coli O104:H4 str. 2009EL-2071 chromosome, complete genome
ATGACTAGGCAAAGATTTATATCTGACGATCATTATAAATTCCAGAGTGAACATTTTATCCGGTTGCACG
GCTGTGATATATCATTATTTCCACTTGAGATTAAAGGTAAAGAGTCAATATCTGATGTATATAGTTATGA
AATAAAATGCTTTAGTAGGACCGACCACAACTCTCTGGATAAGTTACACGGCACGCGTTTGAGTTGTGAG
ATCGGGGAACAATACAATTCGTTACCTGCGCGTTTCATTCATGGTGTGGTCACAAAAGTGATATATAATT
ATGATAACAGCATGCAACATACCTGCATTATTATCTTACAACCAGAGATAGCCGAATTGGCATCTGGTAA
AAGAACAAGAGTATGGTCAAATATAAAGCCATCAGATATTGTAAGCACAATTCTGGAAGACAGTTTATTT
AGTCCGCCACAAGTAATTTTATATAAAGAACAGAATTTGCTGGAGTATAAGATCCAGTACCAGGAGTCAG
ATCTTGACTTTATTAATAGAATTTTGTCTGAGGCGGGCATTTACTATTTCTTTGTTCATAATAGAGATAA
ACATATTATGACATTGGCAGATGATCCTGCATCTCATCCTAAAGCATCTTATGATAAACTGGAACACTTA
CCCTGTGAAAATCTGAAGGAATCGCGTCATGGCTATATCAGGGAATGGTCTTTCACAGAAAGTCTCAAAT
GTCCTTCTGTGACACTTTCAGGTTATAATGAGAGTAATGTCAGTGAAATTACTATAAAGTCAGAAAGTAA
ACTGACGGATGTAAAACCCAGTAAGGGAGTTTATGAAGATATTATCCCAGAGAGAAAGCGTGAGTTGATA
AAGAAACGTTCTGAAGCACTGATAGCATCATGTGACAGTGAACTCAAAATCTGGTCAGGAAAAACGGATT
CATGGTGGTTGTCATGCGGGGAGTGTTTCAGTCTGGACAAACAGGATTACAGAATTACTTCGTTATATCT
TAATGCTGTCAACAATGACAATGAACATGCTGGTTTGTGTTATTGTGATTTGTGTGCTTCAGATAATAAA
AGCTCACTTAATTTCAGCCGTGAATTTAAAACACCTATTATTCCCGGTGTTTTACTTGCCAGAGTGGTCG
GCCCTGACTCCGAAGAATATTATACAGATGATAATGGGCGTGTAAAAATCAGCTTTCTCTGGGGAGAAAA
GTCAGCGGCAGGTACAGATAAAACCTCCTGTTGGGTCCGTGTATCTCAGGTATGGTCCGGGGAGGGATTC
GGTAGTCAGTTTATTCCTCGCATTGGCAGTGAGGTTCTGGTTAGTTTTATACAGGGTAATCCTGACTATC
CAGTTATCGTTGGTACAGTGTATAATGGTCAGAATACATCGCCTTTTTCTCTTCCTGAGAATAATTGTAA
GTCTGGATTTATCACCCGTAGTGTTAAGAATGGTAAAAAAGGAGAAGGTCATCAACTGGTTTTTGATGAT
AAAGAAGGTGAGGAAAAAGTTATAGTGACTTCATCTGGTGATTCTCTCCTGACTGTAAAGAAGGATATGA
TCAGCACTATTAACCGCTCTATGTCGTTAACTATTGCTGAAGGGCGTAATGCTGAAATAAAAAGAGGGAA
TGACAGGCTTGTTCTTAAAGAAGGTGACCTACATAATGATGTACATGGTAATATTAATATAAAAGTTTCG
AACGGAGATTATAATCTTAAAGTGAGCGGGGGAAGTGGTAGTCTTATCACCGATAAGAATCTTACTCTTG
AATCAACACAGTCAATAAAAATAAAAGTGGGTGCAAATGAGATAACGATATCCACATCAGGTATAGATAT
AAAAGCCGCTAAAATTACTATAGAAGGGCAGGTATCGGCAGAGGTCAAAGCGGCCACACTTAAGTTTGAA
AGCCAGGCTATTTCTGAGGTAAAAGGCACCATGTTGACGCTTCAGGGCTCTGCAATGACACAGATAAAAG
GTGGAATCGTGAATATAGGATAA