SecReT6
Protein ID: 407470889
SecReT6 ID703
T6SS typei4b
Gene symbol-
Locus tagO3O_21260
StrainEscherichia coli O104:H4 str. 2009EL-2071
Repliconchromosome [GenBank: NC_018661] [Browse all T6SS(s) in this replicon]
Location [Strand]886002..886934 [+]
Producthypothetical protein
NoteTssG
UniProt IDK0BRG3
KEGG IDeso:O3O_21260
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 7.10E-54, Aligned region: 7..296
Protein Sequence: 310 a.a.     [Download]
>gi|407470889|ref|YP_006782668.1| hypothetical protein O3O_21260 [Escherichia coli O104:H4 str. 2009EL-2071]
MALINNRSKFSFFNKVRVLLKNILKPDESVEDVVDEHFRFTSSLSLDAPDGQIENLYQDEKDGKYHLTLF
DNGLTGATGVLPAAYTEWLIERKLRYNDDAPKAFMDMFDHRMYCLSYLAWQKMHLSGDENRRDNNVLNNV
LLSLGGITPQTVSVTGLAYVAFYSQPVRSLAGLEQLLSLIHQIRVSINPFRGTFENTEPSEQGVLGNCLY
TLGEGPVIGNVRWVVDSHFDVVLGPVDYRKAQELMPGKDSHYFIRQQIRSYIGDVLKFKIYVKIYPGNND
NQLNINNKLGFNLSLGSETENYKERCFCIF
 
Nucleotide Sequence: 933 bp     [Download]
>gi|407466711|ref|NC_018661.1|:886002-886934 Escherichia coli O104:H4 str. 2009EL-2071 chromosome, complete genome
ATGGCTTTGATTAATAACCGGAGTAAATTCAGCTTTTTCAATAAAGTCCGTGTGTTATTGAAAAATATTC
TGAAACCAGATGAAAGCGTTGAAGACGTTGTTGATGAACATTTCAGATTTACATCAAGTCTGTCTTTAGA
TGCACCTGACGGTCAGATAGAGAATCTGTATCAGGATGAGAAGGACGGAAAGTATCATCTCACATTATTC
GATAATGGATTAACCGGGGCTACAGGGGTTCTTCCTGCCGCATATACAGAATGGCTGATTGAAAGGAAAT
TACGTTATAATGACGACGCTCCTAAGGCATTCATGGACATGTTTGACCATAGAATGTATTGTCTTTCTTA
TCTCGCATGGCAAAAAATGCATCTGTCAGGAGATGAAAACAGAAGGGATAATAATGTTCTTAACAATGTT
CTTTTATCTTTAGGCGGGATCACCCCTCAGACAGTTAGTGTGACAGGTCTGGCATACGTTGCATTCTATT
CACAACCAGTAAGATCCCTGGCCGGGCTTGAGCAGTTACTCTCGTTAATACATCAAATCAGAGTGTCCAT
TAATCCTTTTCGTGGCACTTTTGAAAATACAGAACCCAGTGAGCAGGGGGTTCTGGGGAATTGCCTCTAT
ACTCTGGGGGAAGGTCCTGTCATAGGCAATGTTCGTTGGGTGGTTGATTCACATTTTGATGTTGTATTGG
GGCCTGTGGACTATAGAAAAGCACAGGAACTTATGCCGGGAAAAGATTCCCACTATTTTATCAGACAACA
AATAAGATCGTATATAGGTGATGTTCTTAAGTTCAAAATATATGTGAAAATCTATCCCGGTAACAATGAT
AATCAACTTAATATAAACAATAAGCTTGGTTTCAATCTTTCACTCGGTTCTGAAACAGAAAATTATAAAG
AACGGTGCTTTTGTATATTTTGA