SecReT6
Protein ID: 407470890
SecReT6 ID703
T6SS typei4b
Gene symbol-
Locus tagO3O_21265
StrainEscherichia coli O104:H4 str. 2009EL-2071
Repliconchromosome [GenBank: NC_018661] [Browse all T6SS(s) in this replicon]
Location [Strand]884680..886011 [+]
Producthypothetical protein
NoteTssF
UniProt IDK0BT30
KEGG IDeso:O3O_21265
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 1.20E-80, Aligned region: 9..440
Protein Sequence: 443 a.a.     [Download]
>gi|407470890|ref|YP_006782667.1| hypothetical protein O3O_21265 [Escherichia coli O104:H4 str. 2009EL-2071]
MNLDVFDGANFSLDFVRFYLNGPATVTGIIYTLLCDEVDNIVLQRNNDVLYDISANISGAGFYESEVTLP
QKGNVSYIHNLILDYFSFPERFNFIDIEFDSGIELCSGDSVRIEITLKSSAEKYEPDRIERNVSERLFKV
NCSPVVNLFEKKTEPLRLSDGQDEYQVNTDLYSRNEVLIWDINKVTLHRYENDIVKQFPLKNLFGLEHSV
IKQSCNIFWHSSCYRSSSERGNFEESVYIRLSDDGGAQSCIMTGDVLSIDAICTNGNIPSSINNGDPDGD
FDCDIDIAQLRITALNRPSRMLPAMALKGMNWRIVSQLSLNFVLLSGTDGAMKLREMLSIYNYNNNHSIS
IFIEWIKELQITPVSSRLPGIYPPVTARGIDITVTLSKDADMHPECFMFCSFLDHFLGLHAPVNSFTRMI
TVIEHEEHTRRVWPIRAGKLTWL
 
Nucleotide Sequence: 1332 bp     [Download]
>gi|407466711|ref|NC_018661.1|:884680-886011 Escherichia coli O104:H4 str. 2009EL-2071 chromosome, complete genome
TTGAATTTAGACGTTTTCGACGGAGCTAATTTTTCTCTTGATTTTGTAAGATTTTATTTGAATGGTCCGG
CAACGGTTACTGGTATAATATATACATTATTGTGCGATGAGGTCGATAATATCGTTTTGCAGAGAAATAA
TGATGTGTTATATGATATCAGTGCTAATATATCCGGTGCCGGATTTTATGAGAGTGAAGTAACACTTCCA
CAAAAAGGGAACGTTTCTTATATACATAACCTCATACTGGACTATTTTTCTTTTCCAGAACGATTTAACT
TCATTGATATAGAATTTGACTCCGGAATCGAATTATGCTCAGGGGATTCTGTGAGAATAGAAATAACATT
AAAAAGCAGTGCAGAAAAGTATGAGCCAGACAGAATAGAAAGGAATGTTTCTGAAAGACTTTTTAAAGTA
AACTGTTCTCCCGTTGTCAATCTCTTCGAGAAGAAAACTGAACCCCTACGATTATCTGATGGCCAGGATG
AGTATCAGGTAAATACCGATTTATATTCACGTAATGAAGTCTTAATCTGGGATATAAATAAAGTGACATT
GCACAGATATGAAAATGATATAGTCAAGCAGTTTCCGTTAAAAAATTTATTTGGACTTGAACATTCTGTC
ATTAAACAATCGTGCAATATATTCTGGCATAGTTCATGTTATCGCTCGTCTTCTGAAAGAGGGAACTTTG
AGGAAAGTGTATATATTCGTCTGAGCGATGATGGCGGAGCCCAGTCATGTATCATGACTGGGGATGTCCT
TTCAATTGATGCAATATGTACAAATGGTAATATTCCATCATCAATTAATAATGGTGATCCTGATGGTGAT
TTTGATTGTGATATAGATATTGCTCAGCTGCGAATAACTGCGCTGAACCGTCCATCAAGAATGTTGCCGG
CTATGGCATTAAAAGGAATGAACTGGAGAATTGTTTCTCAGTTATCCCTTAATTTTGTGTTGCTCAGTGG
TACTGATGGGGCAATGAAACTGAGAGAAATGCTATCCATATATAACTACAACAATAACCACTCAATATCA
ATTTTTATTGAATGGATTAAAGAGTTACAAATCACACCAGTTTCATCCCGTTTACCCGGCATATATCCGC
CTGTAACTGCTCGTGGAATTGATATTACCGTAACTCTTTCAAAGGATGCAGATATGCACCCTGAATGTTT
CATGTTTTGCTCTTTCCTTGATCACTTTCTTGGGCTACATGCCCCTGTCAATAGCTTTACTCGCATGATT
ACTGTCATTGAACATGAGGAGCACACTCGTCGTGTATGGCCGATAAGAGCAGGAAAGTTAACATGGCTTT
GA