SecReT6
Protein ID: 407470892
SecReT6 ID703
T6SS typei4b
Gene symbol-
Locus tagO3O_21275
StrainEscherichia coli O104:H4 str. 2009EL-2071
Repliconchromosome [GenBank: NC_018661] [Browse all T6SS(s) in this replicon]
Location [Strand]883794..884216 [+]
Producthypothetical protein
NoteTssE
UniProt IDK0BS71
KEGG IDeso:O3O_21275
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 1.40E-06, Aligned region: 26..118
Protein Sequence: 140 a.a.     [Download]
>gi|407470892|ref|YP_006782665.1| hypothetical protein O3O_21275 [Escherichia coli O104:H4 str. 2009EL-2071]
MHSFLQFLRDDNPGSLEDHLNFVPSDDLKYELGMLLSSRPLYLETDELPFVNSSVLNYGIKSSVYVVSAG
EHSDSVNDEISSRILMMLQRYESRLEEPVVEYLSSDDNYSFFSVTALFFMDMVRLCIKWDKNSGEFSLDE
 
Nucleotide Sequence: 423 bp     [Download]
>gi|407466711|ref|NC_018661.1|:883794-884216 Escherichia coli O104:H4 str. 2009EL-2071 chromosome, complete genome
ATGCATTCGTTTCTTCAGTTCTTACGTGATGATAATCCGGGCTCTCTGGAAGATCATCTGAATTTTGTTC
CTTCAGATGATCTGAAATATGAGCTCGGGATGTTATTATCATCACGACCTTTATACCTTGAAACAGATGA
GCTGCCGTTTGTTAATAGTTCTGTCCTGAACTATGGCATAAAGTCATCAGTATATGTAGTTTCTGCAGGT
GAACATAGTGATTCTGTTAATGATGAAATTTCTTCAAGAATATTGATGATGCTCCAGCGTTATGAGTCCC
GGCTGGAGGAACCAGTTGTTGAATATCTTTCCAGTGATGATAATTATTCTTTCTTTTCAGTTACAGCCCT
GTTCTTTATGGACATGGTAAGACTCTGTATTAAATGGGATAAGAACTCAGGAGAATTTTCACTGGATGAA
TAA