SecReT6
Protein ID: 407470893
SecReT6 ID703
T6SS typei4b
Gene symbol-
Locus tagO3O_21280
StrainEscherichia coli O104:H4 str. 2009EL-2071
Repliconchromosome [GenBank: NC_018661] [Browse all T6SS(s) in this replicon]
Location [Strand]883278..883784 [+]
Producthypothetical protein
NoteAaiC (e)
UniProt IDK0BNE9
KEGG IDeso:O3O_21280
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 168 a.a.     [Download]
>gi|407470893|ref|YP_006782664.1| hypothetical protein O3O_21280 [Escherichia coli O104:H4 str. 2009EL-2071]
MVGVMSNSSALSREFVKIEIGGKVIKGNSKVENSGDYFDGHCPQAFHAFSGIDGTVFDLINLKLRVTKHI
QDLLENFFKRGEKEVKIEILRRESTKSGSAYSSFKVVYQGCRMHNMLLAHDNDSNLILELSFTPEESVSI
EMNIPSDDGKSTEKLGPMTYNLYKEALV
 
Nucleotide Sequence: 507 bp     [Download]
>gi|407466711|ref|NC_018661.1|:883278-883784 Escherichia coli O104:H4 str. 2009EL-2071 chromosome, complete genome
ATGGTCGGAGTTATGAGTAATTCTTCCGCTCTTAGCAGGGAGTTTGTCAAAATAGAGATAGGTGGAAAAG
TTATAAAGGGAAATTCAAAAGTTGAAAACAGTGGTGACTACTTTGATGGACATTGTCCTCAGGCATTTCA
CGCTTTTTCAGGAATTGACGGTACTGTTTTTGATTTAATTAATTTGAAGCTTAGGGTTACTAAACACATA
CAAGACCTTCTGGAGAACTTTTTTAAGAGAGGTGAAAAAGAAGTTAAAATAGAAATTTTACGTAGGGAAT
CAACTAAATCAGGTAGTGCATACTCATCATTTAAGGTTGTTTATCAGGGGTGTCGTATGCATAATATGTT
GTTGGCTCATGATAATGATTCAAATCTCATTCTGGAATTGTCGTTTACCCCAGAAGAGAGTGTCTCAATT
GAGATGAATATTCCGTCAGATGATGGAAAAAGTACGGAGAAATTGGGACCAATGACGTACAACTTATATA
AAGAGGCTCTTGTATAA