SecReT6
Protein ID: 407470894
SecReT6 ID703
T6SS typei4b
Gene symbol-
Locus tagO3O_21285
StrainEscherichia coli O104:H4 str. 2009EL-2071
Repliconchromosome [GenBank: NC_018661] [Browse all T6SS(s) in this replicon]
Location [Strand]881790..883268 [+]
Producthypothetical protein
NoteTssC
UniProt IDK0BRG6
KEGG IDeso:O3O_21285
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 2.00E-177, Aligned region: 65..488
Protein Sequence: 492 a.a.     [Download]
>gi|407470894|ref|YP_006782663.1| hypothetical protein O3O_21285 [Escherichia coli O104:H4 str. 2009EL-2071]
MTVASTLGLNETQYATDDCLEEIINNTRAVRQDSEKTRFKLQINNFLAEVASGSLVINSDLIGSIEKRIA
DIDKLMSEQLSLIMHATEFQKIESAWTGLYKLVQASVTENVKYTVLHCTKKELLKDFKSASDFDQSVLFK
NIYESEYGTFGGTPYSAFVGDFYFDNTPQDIDLLEHISHVAASAHAPFLSAIAPGMLSMSSFSELPYPRD
LAKLFETTDYARWRSFRQTDDSRYVGLTLPQSLGRIPYGMKTIPAETFNFEEHISEDNSGKDYLWVNTAF
ELACRIVDAFEEYGWCAAIRGVEGGGLVKSLPAYNYVSHTGERLLQCPTEVAISDRREKELSDLGFIPLV
YCKGTDFAAFFAVQSVNKARLYNTDQANANAKLSSQLQYILATSRFAHYLKVIVRDKVGSFMSRTECQTY
LQNWIMQYVVASDNAGQETKARYPLREASVEVIEVPGSPGNYRAIAWIKPHFQLEGLSMSLRLVADLPSS
VS
 
Nucleotide Sequence: 1479 bp     [Download]
>gi|407466711|ref|NC_018661.1|:881790-883268 Escherichia coli O104:H4 str. 2009EL-2071 chromosome, complete genome
ATGACAGTTGCATCAACATTAGGGCTGAATGAAACTCAGTATGCTACAGATGATTGTCTTGAAGAGATTA
TAAATAATACCAGAGCTGTGAGACAGGATTCTGAAAAGACCAGGTTTAAACTACAGATTAATAATTTCCT
TGCTGAAGTTGCCAGTGGTTCTTTGGTCATTAACAGCGATTTAATCGGTAGTATTGAAAAGCGGATTGCT
GATATTGATAAGTTGATGTCTGAGCAGCTTAGTCTGATTATGCATGCGACTGAATTTCAAAAAATAGAAT
CAGCATGGACGGGACTTTATAAGCTGGTTCAGGCCAGCGTTACTGAAAATGTAAAATACACGGTGTTACA
CTGTACTAAAAAGGAATTGCTCAAAGACTTCAAGTCAGCCTCAGATTTCGATCAGTCTGTCTTATTTAAG
AATATTTATGAAAGCGAGTATGGAACGTTCGGGGGAACACCGTATTCTGCTTTTGTTGGTGATTTCTATT
TTGATAATACACCGCAGGATATTGATTTGCTGGAGCATATTTCCCATGTTGCTGCCAGTGCTCATGCCCC
GTTTCTGAGTGCTATTGCTCCGGGTATGTTGTCCATGAGTTCATTTAGCGAATTACCCTACCCGCGTGAT
CTGGCAAAATTGTTTGAGACAACAGATTATGCCCGTTGGCGTAGTTTCAGGCAGACAGATGACAGTCGTT
ATGTGGGATTGACTTTGCCACAGTCTCTGGGGCGTATTCCATATGGCATGAAGACTATACCTGCCGAAAC
GTTTAATTTTGAAGAGCACATTAGTGAAGATAACTCAGGCAAAGACTATCTGTGGGTAAATACAGCTTTT
GAACTTGCCTGCCGGATAGTTGATGCTTTTGAGGAGTATGGCTGGTGTGCAGCAATTCGGGGCGTGGAAG
GTGGCGGTTTGGTTAAATCATTGCCGGCCTATAATTATGTATCCCATACAGGTGAGCGACTTTTACAATG
TCCGACGGAGGTTGCTATCTCAGACCGTCGGGAAAAAGAATTGTCAGATCTCGGTTTTATTCCTCTGGTT
TATTGTAAAGGTACTGATTTTGCGGCATTTTTCGCTGTTCAGTCGGTAAACAAAGCACGACTGTATAATA
CTGATCAGGCTAATGCGAATGCAAAATTATCCAGTCAGCTTCAGTATATATTAGCAACATCACGATTCGC
ACATTATCTTAAAGTGATTGTTCGTGACAAAGTTGGAAGCTTTATGTCGAGGACAGAATGTCAGACATAT
CTGCAAAACTGGATCATGCAATATGTTGTGGCATCAGATAACGCTGGTCAGGAGACAAAGGCTCGTTATC
CATTACGTGAGGCATCTGTTGAAGTTATTGAAGTCCCTGGAAGTCCGGGAAATTATCGTGCAATTGCATG
GATTAAACCTCATTTTCAGCTTGAGGGTTTAAGTATGTCATTGCGTCTTGTTGCTGATTTACCATCAAGT
GTAAGTTAA