SecReT6
Protein ID: 407470895
SecReT6 ID703
T6SS typei4b
Gene symbol-
Locus tagO3O_21290
StrainEscherichia coli O104:H4 str. 2009EL-2071
Repliconchromosome [GenBank: NC_018661] [Browse all T6SS(s) in this replicon]
Location [Strand]881311..881787 [+]
Producthypothetical protein
NoteTssB
UniProt IDK0BT31
KEGG IDeso:O3O_21290
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 2.40E-45, Aligned region: 8..146
Protein Sequence: 158 a.a.     [Download]
>gi|407470895|ref|YP_006782662.1| hypothetical protein O3O_21290 [Escherichia coli O104:H4 str. 2009EL-2071]
MSNTQHKLDKTRPPRVQITYDVETGDAETAKELPLVIGVLGEYSSSEKPLRERKFISIDKDNFDEVMASM
SPTAHFMVDSVIPGNEGKLDVELRFSCKDDFSPDNVIQQVECLRKLSELRLHLCDLRNRAASNEKLKEKL
QELLVTTNGNPENDESKE
 
Nucleotide Sequence: 477 bp     [Download]
>gi|407466711|ref|NC_018661.1|:881311-881787 Escherichia coli O104:H4 str. 2009EL-2071 chromosome, complete genome
ATGAGCAATACACAACATAAACTTGATAAAACCCGCCCCCCACGAGTACAGATAACGTATGATGTTGAAA
CCGGAGATGCTGAAACTGCGAAAGAGTTACCCCTTGTCATCGGGGTTTTGGGTGAGTACTCTTCGTCAGA
AAAACCATTGAGAGAACGAAAATTCATTAGTATAGATAAAGACAATTTTGATGAAGTTATGGCATCAATG
AGTCCGACTGCTCATTTTATGGTGGACAGTGTTATCCCGGGAAATGAAGGAAAACTGGATGTCGAACTGA
GGTTTAGTTGCAAAGATGATTTTTCTCCCGATAATGTGATTCAACAGGTTGAGTGTCTAAGAAAATTATC
GGAATTGAGGTTGCATCTTTGTGACCTACGAAACAGGGCTGCAAGTAATGAGAAACTGAAAGAAAAACTT
CAGGAATTGCTGGTGACTACTAATGGCAATCCTGAAAACGATGAAAGTAAGGAATAA