SecReT6
Protein ID: 407470905
SecReT6 ID703
T6SS typei4b
Gene symbol-
Locus tagO3O_21360
StrainEscherichia coli O104:H4 str. 2009EL-2071
Repliconchromosome [GenBank: NC_018661] [Browse all T6SS(s) in this replicon]
Location [Strand]871842..873203 [+]
Producthypothetical protein
NoteTssC
UniProt IDK0BT38
KEGG IDeso:O3O_21360
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 3.20E-132, Aligned region: 88..414
Protein Sequence: 453 a.a.     [Download]
>gi|407470905|ref|YP_006782652.1| hypothetical protein O3O_21360 [Escherichia coli O104:H4 str. 2009EL-2071]
MLMSVQKEKNVAESVVSEAHAGDSVYASLFEKINLSPVSALSALDIWQDPQAMSEASADERLTAGMQVFM
ECLAKAGTQVEKLDKALIDHHIAELDYQISRQLDAVLHHPEFQKVESLWRGVKSLVDKTDFRRNVKIELL
DLSKDDLRQDFEDAPEIIQSGLYLQTYVAEYDTPGGEPIAALVSAWEFDASAQDVALLKNISRVAASAHM
PFIGSVGPAFFQKETMEEVAAIKDIGNHFERAEYIKWNAFRETDDARYIGLVMPRVLGRLPYGPDTVPVR
SFNYVEEVKGPDHHKYLWTNASFAFAANMVRSFVTNGWCVQIRGPQAGGAVQDLPIHLYDLGTGNQVKIP
SEVMIPETREFEFANLGFIPLSYYKNRDYACFFSANSAQKPALYDTPDATANSRINARLVGVFLLLAMLA
SFMNNQRLVRSVGEHLTAWHRMRGYLTERQLIL
 
Nucleotide Sequence: 1362 bp     [Download]
>gi|407466711|ref|NC_018661.1|:871842-873203 Escherichia coli O104:H4 str. 2009EL-2071 chromosome, complete genome
ATGCTGATGTCTGTACAGAAAGAAAAGAACGTTGCAGAGAGCGTGGTATCTGAAGCGCATGCCGGCGACA
GCGTATATGCTTCCCTGTTTGAAAAAATTAACCTGAGTCCGGTATCTGCCCTGAGTGCACTGGATATCTG
GCAGGATCCACAGGCCATGTCAGAAGCATCTGCAGATGAACGTCTGACGGCAGGGATGCAGGTGTTTATG
GAGTGTCTGGCAAAAGCCGGCACGCAGGTGGAAAAACTCGATAAAGCGCTGATTGACCATCATATTGCAG
AGCTTGATTATCAGATCAGCCGTCAACTGGATGCTGTGCTTCATCATCCGGAATTTCAGAAAGTGGAGTC
GCTGTGGCGGGGCGTGAAGTCCCTGGTGGATAAAACGGACTTCCGCCGTAATGTGAAAATTGAGCTGCTG
GATCTGTCCAAAGACGATCTGCGTCAGGATTTTGAGGATGCGCCGGAAATTATTCAGAGCGGCCTTTATC
TGCAGACCTATGTGGCTGAGTATGACACGCCGGGTGGTGAGCCCATTGCCGCCCTGGTTTCAGCCTGGGA
GTTTGATGCATCTGCACAGGACGTGGCGTTGCTGAAAAATATTTCCCGGGTGGCGGCATCTGCACATATG
CCGTTTATTGGTTCAGTTGGCCCGGCGTTCTTCCAGAAAGAAACCATGGAAGAGGTGGCTGCCATCAAGG
ATATTGGCAACCACTTTGAGCGTGCCGAGTACATCAAGTGGAATGCTTTCCGTGAGACGGACGATGCCCG
CTATATTGGCCTGGTGATGCCCCGTGTACTGGGACGCCTGCCGTATGGCCCGGATACCGTACCTGTCCGC
AGCTTTAACTATGTTGAAGAGGTGAAAGGACCGGACCACCATAAATATCTCTGGACGAACGCGTCTTTTG
CCTTTGCAGCCAACATGGTGCGCAGTTTTGTCACCAACGGCTGGTGTGTTCAGATCCGTGGGCCTCAGGC
CGGTGGTGCGGTGCAGGATTTGCCAATCCATTTGTATGATCTGGGAACCGGTAATCAGGTCAAAATTCCG
TCAGAGGTGATGATCCCGGAAACGCGGGAGTTTGAATTCGCGAATCTGGGCTTTATTCCGCTCTCTTACT
ACAAGAACCGGGATTATGCCTGCTTCTTCTCTGCTAACTCCGCCCAGAAACCGGCGCTGTACGATACGCC
GGATGCAACGGCGAACAGTCGTATTAATGCCCGTCTTGTCGGTGTTTTTCTTCTGCTGGCTATGCTGGCG
TCTTTTATGAATAACCAGCGGCTGGTTCGCAGCGTGGGGGAACACCTGACGGCCTGGCACCGGATGCGCG
GATATCTGACAGAACGTCAGTTAATCCTGTAG