SecReT6
Protein ID: 407470906
SecReT6 ID703
T6SS typei4b
Gene symbol-
Locus tagO3O_21365
StrainEscherichia coli O104:H4 str. 2009EL-2071
Repliconchromosome [GenBank: NC_018661] [Browse all T6SS(s) in this replicon]
Location [Strand]871323..871820 [+]
Producthypothetical protein
NoteTssB
UniProt IDK0BTV2
KEGG IDeso:O3O_21365
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 8.30E-52, Aligned region: 6..158
Protein Sequence: 165 a.a.     [Download]
>gi|407470906|ref|YP_006782651.1| hypothetical protein O3O_21365 [Escherichia coli O104:H4 str. 2009EL-2071]
MSSSFQNEIPKARVNLKLDLHTGGGQKKVELPLKLLVAGDFSNGQEERPLSERVKTDINKNNFNDVLADI
SPSVHLNVENTLAGDGSEESISLTFRNMNDFTPEQVARQIPRLKAMLAMRSLLRDLKANLLDNVTFRKEL
EKILRDPALSQTLRDELRALVPEKA
 
Nucleotide Sequence: 498 bp     [Download]
>gi|407466711|ref|NC_018661.1|:871323-871820 Escherichia coli O104:H4 str. 2009EL-2071 chromosome, complete genome
ATGAGCAGTTCGTTTCAGAATGAAATCCCGAAAGCAAGGGTAAATCTGAAATTAGACCTACATACGGGGG
GTGGGCAGAAGAAAGTGGAGCTTCCGCTCAAACTTCTGGTTGCCGGTGATTTCAGTAACGGACAGGAAGA
GCGTCCACTGTCAGAGCGTGTAAAAACGGATATTAATAAAAACAATTTTAATGATGTTCTGGCAGATATC
TCCCCGTCTGTACATCTGAATGTGGAGAACACGCTTGCCGGTGATGGCTCTGAAGAGAGCATCAGCCTGA
CTTTCCGCAATATGAACGATTTCACGCCAGAGCAGGTCGCCCGACAGATTCCCCGTCTTAAAGCCATGCT
GGCCATGCGTAGCCTTCTGCGGGACCTGAAAGCCAATCTGCTGGATAACGTGACTTTCCGTAAAGAGCTG
GAAAAAATTCTGCGTGACCCGGCACTGAGTCAGACGCTGCGTGATGAACTGCGTGCACTGGTGCCGGAAA
AGGCGTGA