SecReT6
Protein ID: 407480438
SecReT6 ID701
T6SS typei4b
Gene symbol-
Locus tagO3K_04285
StrainEscherichia coli O104:H4 str. 2011C-3493
Repliconchromosome [GenBank: NC_018658] [Browse all T6SS(s) in this replicon]
Location [Strand]877798..878295 [+]
Producthypothetical protein
NoteTssB
UniProt IDK0AJV7
KEGG IDesl:O3K_04285
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 8.30E-52, Aligned region: 6..158
Protein Sequence: 165 a.a.     [Download]
>gi|407480438|ref|YP_006777587.1| hypothetical protein O3K_04285 [Escherichia coli O104:H4 str. 2011C-3493]
MSSSFQNEIPKARVNLKLDLHTGGGQKKVELPLKLLVAGDFSNGQEERPLSERVKTDINKNNFNDVLADI
SPSVHLNVENTLAGDGSEESISLTFRNMNDFTPEQVARQIPRLKAMLAMRSLLRDLKANLLDNVTFRKEL
EKILRDPALSQTLRDELRALVPEKA
 
Nucleotide Sequence: 498 bp     [Download]
>gi|407479587|ref|NC_018658.1|:877798-878295 Escherichia coli O104:H4 str. 2011C-3493 chromosome, complete genome
ATGAGCAGTTCGTTTCAGAATGAAATCCCGAAAGCAAGGGTAAATCTGAAATTAGACCTACATACGGGGG
GTGGGCAGAAGAAAGTGGAGCTTCCGCTCAAACTTCTGGTTGCCGGTGATTTCAGTAACGGACAGGAAGA
GCGTCCACTGTCAGAGCGTGTAAAAACGGATATTAATAAAAACAATTTTAATGATGTTCTGGCAGATATC
TCCCCGTCTGTACATCTGAATGTGGAGAACACGCTTGCCGGTGATGGCTCTGAAGAGAGCATCAGCCTGA
CTTTCCGCAATATGAACGATTTCACGCCAGAGCAGGTCGCCCGACAGATTCCCCGTCTTAAAGCCATGCT
GGCCATGCGTAGCCTTCTGCGGGACCTGAAAGCCAATCTGCTGGATAACGTGACTTTCCGTAAAGAGCTG
GAAAAAATTCTGCGTGACCCGGCACTGAGTCAGACGCTGCGTGATGAACTGCGTGCACTGGTGCCGGAAA
AGGCGTGA