SecReT6
Protein ID: 407480439
SecReT6 ID701
T6SS typei4b
Gene symbol-
Locus tagO3K_04290
StrainEscherichia coli O104:H4 str. 2011C-3493
Repliconchromosome [GenBank: NC_018658] [Browse all T6SS(s) in this replicon]
Location [Strand]878317..879678 [+]
Producthypothetical protein
NoteTssC
UniProt IDK0AJ16
KEGG IDesl:O3K_04290
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 3.20E-132, Aligned region: 88..414
Protein Sequence: 453 a.a.     [Download]
>gi|407480439|ref|YP_006777588.1| hypothetical protein O3K_04290 [Escherichia coli O104:H4 str. 2011C-3493]
MLMSVQKEKNVAESVVSEAHAGDSVYASLFEKINLSPVSALSALDIWQDPQAMSEASADERLTAGMQVFM
ECLAKAGTQVEKLDKALIDHHIAELDYQISRQLDAVLHHPEFQKVESLWRGVKSLVDKTDFRRNVKIELL
DLSKDDLRQDFEDAPEIIQSGLYLQTYVAEYDTPGGEPIAALVSAWEFDASAQDVALLKNISRVAASAHM
PFIGSVGPAFFQKETMEEVAAIKDIGNHFERAEYIKWNAFRETDDARYIGLVMPRVLGRLPYGPDTVPVR
SFNYVEEVKGPDHHKYLWTNASFAFAANMVRSFVTNGWCVQIRGPQAGGAVQDLPIHLYDLGTGNQVKIP
SEVMIPETREFEFANLGFIPLSYYKNRDYACFFSANSAQKPALYDTPDATANSRINARLVGVFLLLAMLA
SFMNNQRLVRSVGEHLTAWHRMRGYLTERQLIL
 
Nucleotide Sequence: 1362 bp     [Download]
>gi|407479587|ref|NC_018658.1|:878317-879678 Escherichia coli O104:H4 str. 2011C-3493 chromosome, complete genome
ATGCTGATGTCTGTACAGAAAGAAAAGAACGTTGCAGAGAGCGTGGTATCTGAAGCGCATGCCGGCGACA
GCGTATATGCTTCCCTGTTTGAAAAAATTAACCTGAGTCCGGTATCTGCCCTGAGTGCACTGGATATCTG
GCAGGATCCACAGGCCATGTCAGAAGCATCTGCAGATGAACGTCTGACGGCAGGGATGCAGGTGTTTATG
GAGTGTCTGGCAAAAGCCGGCACGCAGGTGGAAAAACTCGATAAAGCGCTGATTGACCATCATATTGCAG
AGCTTGATTATCAGATCAGCCGTCAACTGGATGCTGTGCTTCATCATCCGGAATTTCAGAAAGTGGAGTC
GCTGTGGCGGGGCGTGAAGTCCCTGGTGGATAAAACGGACTTCCGCCGTAATGTGAAAATTGAGCTGCTG
GATCTGTCCAAAGACGATCTGCGTCAGGATTTTGAGGATGCGCCGGAAATTATTCAGAGCGGCCTTTATC
TGCAGACCTATGTGGCTGAGTATGACACGCCGGGTGGTGAGCCCATTGCCGCCCTGGTTTCAGCCTGGGA
GTTTGATGCATCTGCACAGGACGTGGCGTTGCTGAAAAATATTTCCCGGGTGGCGGCATCTGCACATATG
CCGTTTATTGGTTCAGTTGGCCCGGCGTTCTTCCAGAAAGAAACCATGGAAGAGGTGGCTGCCATCAAGG
ATATTGGCAACCACTTTGAGCGTGCCGAGTACATCAAGTGGAATGCTTTCCGTGAGACGGACGATGCCCG
CTATATTGGCCTGGTGATGCCCCGTGTACTGGGACGCCTGCCGTATGGCCCGGATACCGTACCTGTCCGC
AGCTTTAACTATGTTGAAGAGGTGAAAGGACCGGACCACCATAAATATCTCTGGACGAACGCGTCTTTTG
CCTTTGCAGCCAACATGGTGCGCAGTTTTGTCACCAACGGCTGGTGTGTTCAGATCCGTGGGCCTCAGGC
CGGTGGTGCGGTGCAGGATTTGCCAATCCATTTGTATGATCTGGGAACCGGTAATCAGGTCAAAATTCCG
TCAGAGGTGATGATCCCGGAAACGCGGGAGTTTGAATTCGCGAATCTGGGCTTTATTCCGCTCTCTTACT
ACAAGAACCGGGATTATGCCTGCTTCTTCTCTGCTAACTCCGCCCAGAAACCGGCGCTGTACGATACGCC
GGATGCAACGGCGAACAGTCGTATTAATGCCCGTCTTGTCGGTGTTTTTCTTCTGCTGGCTATGCTGGCG
TCTTTTATGAATAACCAGCGGCTGGTTCGCAGCGTGGGGGAACACCTGACGGCCTGGCACCGGATGCGCG
GATATCTGACAGAACGTCAGTTAATCCTGTAG