SecReT6
Protein ID: 407480449
SecReT6 ID701
T6SS typei4b
Gene symbol-
Locus tagO3K_04355
StrainEscherichia coli O104:H4 str. 2011C-3493
Repliconchromosome [GenBank: NC_018658] [Browse all T6SS(s) in this replicon]
Location [Strand]887786..888262 [+]
Producthypothetical protein
NoteTssB
UniProt IDK0AJ26
KEGG IDesl:O3K_04355
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 2.40E-45, Aligned region: 8..146
Protein Sequence: 158 a.a.     [Download]
>gi|407480449|ref|YP_006777598.1| hypothetical protein O3K_04355 [Escherichia coli O104:H4 str. 2011C-3493]
MSNTQHKLDKTRPPRVQITYDVETGDAETAKELPLVIGVLGEYSSSEKPLRERKFISIDKDNFDEVMASM
SPTAHFMVDSVIPGNEGKLDVELRFSCKDDFSPDNVIQQVECLRKLSELRLHLCDLRNRAASNEKLKEKL
QELLVTTNGNPENDESKE
 
Nucleotide Sequence: 477 bp     [Download]
>gi|407479587|ref|NC_018658.1|:887786-888262 Escherichia coli O104:H4 str. 2011C-3493 chromosome, complete genome
ATGAGCAATACACAACATAAACTTGATAAAACCCGCCCCCCACGAGTACAGATAACGTATGATGTTGAAA
CCGGAGATGCTGAAACTGCGAAAGAGTTACCCCTTGTCATCGGGGTTTTGGGTGAGTACTCTTCGTCAGA
AAAACCATTGAGAGAACGAAAATTCATTAGTATAGATAAAGACAATTTTGATGAAGTTATGGCATCAATG
AGTCCGACTGCTCATTTTATGGTGGACAGTGTTATCCCGGGAAATGAAGGAAAACTGGATGTCGAACTGA
GGTTTAGTTGCAAAGATGATTTTTCTCCCGATAATGTGATTCAACAGGTTGAGTGTCTAAGAAAATTATC
GGAATTGAGGTTGCATCTTTGTGACCTACGAAACAGGGCTGCAAGTAATGAGAAACTGAAAGAAAAACTT
CAGGAATTGCTGGTGACTACTAATGGCAATCCTGAAAACGATGAAAGTAAGGAATAA