SecReT6
Protein ID: 407480450
SecReT6 ID701
T6SS typei4b
Gene symbol-
Locus tagO3K_04360
StrainEscherichia coli O104:H4 str. 2011C-3493
Repliconchromosome [GenBank: NC_018658] [Browse all T6SS(s) in this replicon]
Location [Strand]888265..889743 [+]
Producthypothetical protein
NoteTssC
UniProt IDK0AGK1
KEGG IDesl:O3K_04360
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 2.00E-177, Aligned region: 65..488
Protein Sequence: 492 a.a.     [Download]
>gi|407480450|ref|YP_006777599.1| hypothetical protein O3K_04360 [Escherichia coli O104:H4 str. 2011C-3493]
MTVASTLGLNETQYATDDCLEEIINNTRAVRQDSEKTRFKLQINNFLAEVASGSLVINSDLIGSIEKRIA
DIDKLMSEQLSLIMHATEFQKIESAWTGLYKLVQASVTENVKYTVLHCTKKELLKDFKSASDFDQSVLFK
NIYESEYGTFGGTPYSAFVGDFYFDNTPQDIDLLEHISHVAASAHAPFLSAIAPGMLSMSSFSELPYPRD
LAKLFETTDYARWRSFRQTDDSRYVGLTLPQSLGRIPYGMKTIPAETFNFEEHISEDNSGKDYLWVNTAF
ELACRIVDAFEEYGWCAAIRGVEGGGLVKSLPAYNYVSHTGERLLQCPTEVAISDRREKELSDLGFIPLV
YCKGTDFAAFFAVQSVNKARLYNTDQANANAKLSSQLQYILATSRFAHYLKVIVRDKVGSFMSRTECQTY
LQNWIMQYVVASDNAGQETKARYPLREASVEVIEVPGSPGNYRAIAWIKPHFQLEGLSMSLRLVADLPSS
VS
 
Nucleotide Sequence: 1479 bp     [Download]
>gi|407479587|ref|NC_018658.1|:888265-889743 Escherichia coli O104:H4 str. 2011C-3493 chromosome, complete genome
ATGACAGTTGCATCAACATTAGGGCTGAATGAAACTCAGTATGCTACAGATGATTGTCTTGAAGAGATTA
TAAATAATACCAGAGCTGTGAGACAGGATTCTGAAAAGACCAGGTTTAAACTACAGATTAATAATTTCCT
TGCTGAAGTTGCCAGTGGTTCTTTGGTCATTAACAGCGATTTAATCGGTAGTATTGAAAAGCGGATTGCT
GATATTGATAAGTTGATGTCTGAGCAGCTTAGTCTGATTATGCATGCGACTGAATTTCAAAAAATAGAAT
CAGCATGGACGGGACTTTATAAGCTGGTTCAGGCCAGCGTTACTGAAAATGTAAAATACACGGTGTTACA
CTGTACTAAAAAGGAATTGCTCAAAGACTTCAAGTCAGCCTCAGATTTCGATCAGTCTGTCTTATTTAAG
AATATTTATGAAAGCGAGTATGGAACGTTCGGGGGAACACCGTATTCTGCTTTTGTTGGTGATTTCTATT
TTGATAATACACCGCAGGATATTGATTTGCTGGAGCATATTTCCCATGTTGCTGCCAGTGCTCATGCCCC
GTTTCTGAGTGCTATTGCTCCGGGTATGTTGTCCATGAGTTCATTTAGCGAATTACCCTACCCGCGTGAT
CTGGCAAAATTGTTTGAGACAACAGATTATGCCCGTTGGCGTAGTTTCAGGCAGACAGATGACAGTCGTT
ATGTGGGATTGACTTTGCCACAGTCTCTGGGGCGTATTCCATATGGCATGAAGACTATACCTGCCGAAAC
GTTTAATTTTGAAGAGCACATTAGTGAAGATAACTCAGGCAAAGACTATCTGTGGGTAAATACAGCTTTT
GAACTTGCCTGCCGGATAGTTGATGCTTTTGAGGAGTATGGCTGGTGTGCAGCAATTCGGGGCGTGGAAG
GTGGCGGTTTGGTTAAATCATTGCCGGCCTATAATTATGTATCCCATACAGGTGAGCGACTTTTACAATG
TCCGACGGAGGTTGCTATCTCAGACCGTCGGGAAAAAGAATTGTCAGATCTCGGTTTTATTCCTCTGGTT
TATTGTAAAGGTACTGATTTTGCGGCATTTTTCGCTGTTCAGTCGGTAAACAAAGCACGACTGTATAATA
CTGATCAGGCTAATGCGAATGCAAAATTATCCAGTCAGCTTCAGTATATATTAGCAACATCACGATTCGC
ACATTATCTTAAAGTGATTGTTCGTGACAAAGTTGGAAGCTTTATGTCGAGGACAGAATGTCAGACATAT
CTGCAAAACTGGATCATGCAATATGTTGTGGCATCAGATAACGCTGGTCAGGAGACAAAGGCTCGTTATC
CATTACGTGAGGCATCTGTTGAAGTTATTGAAGTCCCTGGAAGTCCGGGAAATTATCGTGCAATTGCATG
GATTAAACCTCATTTTCAGCTTGAGGGTTTAAGTATGTCATTGCGTCTTGTTGCTGATTTACCATCAAGT
GTAAGTTAA