SecReT6
Protein ID: 407480454
SecReT6 ID701
T6SS typei4b
Gene symbol-
Locus tagO3K_04380
StrainEscherichia coli O104:H4 str. 2011C-3493
Repliconchromosome [GenBank: NC_018658] [Browse all T6SS(s) in this replicon]
Location [Strand]891155..892486 [+]
Producthypothetical protein
NoteTssF
UniProt IDK0AJ31
KEGG IDesl:O3K_04380
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 1.20E-80, Aligned region: 9..440
Protein Sequence: 443 a.a.     [Download]
>gi|407480454|ref|YP_006777603.1| hypothetical protein O3K_04380 [Escherichia coli O104:H4 str. 2011C-3493]
MNLDVFDGANFSLDFVRFYLNGPATVTGIIYTLLCDEVDNIVLQRNNDVLYDISANISGAGFYESEVTLP
QKGNVSYIHNLILDYFSFPERFNFIDIEFDSGIELCSGDSVRIEITLKSSAEKYEPDRIERNVSERLFKV
NCSPVVNLFEKKTEPLRLSDGQDEYQVNTDLYSRNEVLIWDINKVTLHRYENDIVKQFPLKNLFGLEHSV
IKQSCNIFWHSSCYRSSSERGNFEESVYIRLSDDGGAQSCIMTGDVLSIDAICTNGNIPSSINNGDPDGD
FDCDIDIAQLRITALNRPSRMLPAMALKGMNWRIVSQLSLNFVLLSGTDGAMKLREMLSIYNYNNNHSIS
IFIEWIKELQITPVSSRLPGIYPPVTARGIDITVTLSKDADMHPECFMFCSFLDHFLGLHAPVNSFTRMI
TVIEHEEHTRRVWPIRAGKLTWL
 
Nucleotide Sequence: 1332 bp     [Download]
>gi|407479587|ref|NC_018658.1|:891155-892486 Escherichia coli O104:H4 str. 2011C-3493 chromosome, complete genome
TTGAATTTAGACGTTTTCGACGGAGCTAATTTTTCTCTTGATTTTGTAAGATTTTATTTGAATGGTCCGG
CAACGGTTACTGGTATAATATATACATTATTGTGCGATGAGGTCGATAATATCGTTTTGCAGAGAAATAA
TGATGTGTTATATGATATCAGTGCTAATATATCCGGTGCCGGATTTTATGAGAGTGAAGTAACACTTCCA
CAAAAAGGGAACGTTTCTTATATACATAACCTCATACTGGACTATTTTTCTTTTCCAGAACGATTTAACT
TCATTGATATAGAATTTGACTCCGGAATCGAATTATGCTCAGGGGATTCTGTGAGAATAGAAATAACATT
AAAAAGCAGTGCAGAAAAGTATGAGCCAGACAGAATAGAAAGGAATGTTTCTGAAAGACTTTTTAAAGTA
AACTGTTCTCCCGTTGTCAATCTCTTCGAGAAGAAAACTGAACCCCTACGATTATCTGATGGCCAGGATG
AGTATCAGGTAAATACCGATTTATATTCACGTAATGAAGTCTTAATCTGGGATATAAATAAAGTGACATT
GCACAGATATGAAAATGATATAGTCAAGCAGTTTCCGTTAAAAAATTTATTTGGACTTGAACATTCTGTC
ATTAAACAATCGTGCAATATATTCTGGCATAGTTCATGTTATCGCTCGTCTTCTGAAAGAGGGAACTTTG
AGGAAAGTGTATATATTCGTCTGAGCGATGATGGCGGAGCCCAGTCATGTATCATGACTGGGGATGTCCT
TTCAATTGATGCAATATGTACAAATGGTAATATTCCATCATCAATTAATAATGGTGATCCTGATGGTGAT
TTTGATTGTGATATAGATATTGCTCAGCTGCGAATAACTGCGCTGAACCGTCCATCAAGAATGTTGCCGG
CTATGGCATTAAAAGGAATGAACTGGAGAATTGTTTCTCAGTTATCCCTTAATTTTGTGTTGCTCAGTGG
TACTGATGGGGCAATGAAACTGAGAGAAATGCTATCCATATATAACTACAACAATAACCACTCAATATCA
ATTTTTATTGAATGGATTAAAGAGTTACAAATCACACCAGTTTCATCCCGTTTACCCGGCATATATCCGC
CTGTAACTGCTCGTGGAATTGATATTACCGTAACTCTTTCAAAGGATGCAGATATGCACCCTGAATGTTT
CATGTTTTGCTCTTTCCTTGATCACTTTCTTGGGCTACATGCCCCTGTCAATAGCTTTACTCGCATGATT
ACTGTCATTGAACATGAGGAGCACACTCGTCGTGTATGGCCGATAAGAGCAGGAAAGTTAACATGGCTTT
GA