SecReT6
Protein ID: 407480455
SecReT6 ID701
T6SS typei4b
Gene symbol-
Locus tagO3K_04385
StrainEscherichia coli O104:H4 str. 2011C-3493
Repliconchromosome [GenBank: NC_018658] [Browse all T6SS(s) in this replicon]
Location [Strand]892477..893409 [+]
Producthypothetical protein
NoteTssG
UniProt IDK0AGL0
KEGG IDesl:O3K_04385
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 7.10E-54, Aligned region: 7..296
Protein Sequence: 310 a.a.     [Download]
>gi|407480455|ref|YP_006777604.1| hypothetical protein O3K_04385 [Escherichia coli O104:H4 str. 2011C-3493]
MALINNRSKFSFFNKVRVLLKNILKPDESVEDVVDEHFRFTSSLSLDAPDGQIENLYQDEKDGKYHLTLF
DNGLTGATGVLPAAYTEWLIERKLRYNDDAPKAFMDMFDHRMYCLSYLAWQKMHLSGDENRRDNNVLNNV
LLSLGGITPQTVSVTGLAYVAFYSQPVRSLAGLEQLLSLIHQIRVSINPFRGTFENTEPSEQGVLGNCLY
TLGEGPVIGNVRWVVDSHFDVVLGPVDYRKAQELMPGKDSHYFIRQQIRSYIGDVLKFKIYVKIYPGNND
NQLNINNKLGFNLSLGSETENYKERCFCIF
 
Nucleotide Sequence: 933 bp     [Download]
>gi|407479587|ref|NC_018658.1|:892477-893409 Escherichia coli O104:H4 str. 2011C-3493 chromosome, complete genome
ATGGCTTTGATTAATAACCGGAGTAAATTCAGCTTTTTCAATAAAGTCCGTGTGTTATTGAAAAATATTC
TGAAACCAGATGAAAGCGTTGAAGACGTTGTTGATGAACATTTCAGATTTACATCAAGTCTGTCTTTAGA
TGCACCTGACGGTCAGATAGAGAATCTGTATCAGGATGAGAAGGACGGAAAGTATCATCTCACATTATTC
GATAATGGATTAACCGGGGCTACAGGGGTTCTTCCTGCCGCATATACAGAATGGCTGATTGAAAGGAAAT
TACGTTATAATGACGACGCTCCTAAGGCATTCATGGACATGTTTGACCATAGAATGTATTGTCTTTCTTA
TCTCGCATGGCAAAAAATGCATCTGTCAGGAGATGAAAACAGAAGGGATAATAATGTTCTTAACAATGTT
CTTTTATCTTTAGGCGGGATCACCCCTCAGACAGTTAGTGTGACAGGTCTGGCATACGTTGCATTCTATT
CACAACCAGTAAGATCCCTGGCCGGGCTTGAGCAGTTACTCTCGTTAATACATCAAATCAGAGTGTCCAT
TAATCCTTTTCGTGGCACTTTTGAAAATACAGAACCCAGTGAGCAGGGGGTTCTGGGGAATTGCCTCTAT
ACTCTGGGGGAAGGTCCTGTCATAGGCAATGTTCGTTGGGTGGTTGATTCACATTTTGATGTTGTATTGG
GGCCTGTGGACTATAGAAAAGCACAGGAACTTATGCCGGGAAAAGATTCCCACTATTTTATCAGACAACA
AATAAGATCGTATATAGGTGATGTTCTTAAGTTCAAAATATATGTGAAAATCTATCCCGGTAACAATGAT
AATCAACTTAATATAAACAATAAGCTTGGTTTCAATCTTTCACTCGGTTCTGAAACAGAAAATTATAAAG
AACGGTGCTTTTGTATATTTTGA