SecReT6
Protein ID: 407480459
SecReT6 ID701
T6SS typei4b
Gene symbol-
Locus tagO3K_04405
StrainEscherichia coli O104:H4 str. 2011C-3493
Repliconchromosome [GenBank: NC_018658] [Browse all T6SS(s) in this replicon]
Location [Strand]896195..897271 [+]
Producthypothetical protein
NoteTssA
UniProt IDK0AJ37
KEGG IDesl:O3K_04405
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 3.40E-22, Aligned region: 57..117
Protein Sequence: 358 a.a.     [Download]
>gi|407480459|ref|YP_006777608.1| hypothetical protein O3K_04405 [Escherichia coli O104:H4 str. 2011C-3493]
MNKIETDTLLLPVIGESPAGDDIEYDPVYSEIREARQNDPDYMSQGEWAVSEPRRADWRKVRKLCEVTLR
NKSKDLQISCWYVESLTHLYALEGMHCGLEYLAKFISQYWTTCWPSQEEGQEIRYSKLVRLDIDLSEYLK
AYPLLEDKEITLSEWYKVLSFEHGASLSEAGKERLIESEGDHSVESFKRAVGKYNPRKVSEQLLQLYDLP
DKIDEIESSYFFHTHEDIHHIFAKTRHIISEITELLSRFLPQETLDHSSVSQFLGKPDSRDTRTALPEEK
KEFYSALTPSTDKEMSREKAIEQLEKIAIFFRQSEPTSPVPYLLERAIRWSTMTMSEWLEELLKDNDSME
QINRVLKG
 
Nucleotide Sequence: 1077 bp     [Download]
>gi|407479587|ref|NC_018658.1|:896195-897271 Escherichia coli O104:H4 str. 2011C-3493 chromosome, complete genome
ATGAACAAAATAGAAACGGATACATTACTGCTTCCTGTTATAGGAGAATCGCCGGCAGGTGATGATATTG
AGTATGATCCGGTGTATAGCGAAATACGGGAGGCAAGACAAAATGATCCGGACTATATGTCTCAGGGGGA
ATGGGCTGTCAGTGAACCCCGCAGAGCTGACTGGAGAAAAGTAAGAAAATTATGTGAGGTTACTTTACGT
AATAAGAGTAAGGACCTACAAATTAGTTGCTGGTATGTGGAGTCCTTGACGCATTTATATGCTCTGGAAG
GGATGCATTGCGGATTGGAATATCTTGCAAAGTTTATTTCTCAGTACTGGACTACATGCTGGCCATCGCA
GGAAGAAGGTCAGGAAATTCGTTACAGTAAATTGGTTCGTCTTGATATAGATTTATCAGAGTATCTGAAA
GCATATCCTCTTCTTGAGGATAAGGAAATCACACTTTCTGAATGGTATAAGGTGTTATCGTTTGAACATG
GAGCAAGTTTGTCAGAAGCTGGAAAAGAAAGATTAATAGAGAGCGAAGGTGATCACTCTGTTGAGTCCTT
CAAAAGAGCTGTAGGAAAATATAATCCCCGCAAGGTTAGTGAGCAACTTCTCCAGCTTTATGATCTACCT
GACAAAATTGATGAGATTGAATCTTCTTACTTCTTTCATACGCATGAAGATATACATCATATTTTCGCAA
AAACCAGACATATCATCAGTGAGATAACCGAGTTACTGAGTCGTTTTTTGCCGCAAGAAACACTGGATCA
CAGTTCAGTTTCTCAATTTCTAGGCAAACCCGATAGCAGAGACACAAGGACAGCACTTCCTGAGGAAAAA
AAGGAATTTTATTCTGCATTAACACCCTCAACAGATAAAGAGATGTCAAGGGAGAAAGCTATAGAGCAAC
TGGAGAAAATAGCTATTTTTTTCAGGCAATCTGAACCAACCAGTCCTGTTCCTTATCTTCTGGAGAGGGC
CATACGTTGGTCAACAATGACTATGTCAGAATGGCTTGAGGAACTACTTAAAGATAATGACTCTATGGAA
CAAATAAACCGTGTCTTAAAAGGATGA