SecReT6
Protein ID: 407480460
SecReT6 ID701
T6SS typei4b
Gene symbol-
Locus tagO3K_04410
StrainEscherichia coli O104:H4 str. 2011C-3493
Repliconchromosome [GenBank: NC_018658] [Browse all T6SS(s) in this replicon]
Location [Strand]897279..897830 [+]
Producthypothetical protein
NoteTssJ
UniProt IDK0AGL6
KEGG IDesl:O3K_04410
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 5.10E-18, Aligned region: 15..152
Protein Sequence: 183 a.a.     [Download]
>gi|407480460|ref|YP_006777609.1| hypothetical protein O3K_04410 [Escherichia coli O104:H4 str. 2011C-3493]
MTIKCLLLAVMVFPFFITACSDKYSEQDRVQAINNADAPFGAGLLTFQISSDTQLNSLNEISNSCALLFL
QASDKNTLQDIMNNPVLIKQFFIGTGKVDGILKVDKYVAMPGQEITLHIDRNEGTKYVGVIAGYYPFPGK
QHMLLLDIPVDVVEEGWWNKSLHASLLPLSKKISMGKESISMK
 
Nucleotide Sequence: 552 bp     [Download]
>gi|407479587|ref|NC_018658.1|:897279-897830 Escherichia coli O104:H4 str. 2011C-3493 chromosome, complete genome
ATGACTATTAAGTGCCTGCTACTAGCGGTTATGGTATTCCCCTTTTTCATCACTGCCTGTTCTGATAAGT
ATTCTGAACAGGATAGAGTGCAGGCTATCAACAATGCCGATGCTCCATTTGGCGCCGGCTTGCTTACTTT
TCAGATATCATCTGATACGCAATTAAACTCACTTAACGAGATATCCAACAGCTGTGCATTATTATTCTTA
CAGGCTTCAGATAAAAATACATTACAGGACATAATGAATAATCCTGTGTTAATCAAACAGTTTTTTATCG
GGACAGGTAAGGTTGATGGCATTCTTAAAGTTGATAAATACGTGGCTATGCCGGGGCAGGAGATAACGCT
ACATATAGACAGGAATGAAGGGACTAAATATGTAGGTGTGATTGCTGGATACTATCCATTTCCTGGAAAA
CAGCATATGTTACTCTTAGATATTCCGGTTGATGTTGTTGAGGAAGGTTGGTGGAACAAATCATTACATG
CATCACTCTTACCTCTTTCCAAAAAGATATCGATGGGTAAAGAAAGTATCAGTATGAAATAA