SecReT6
Protein ID: 407480461
SecReT6 ID701
T6SS typei4b
Gene symbol-
Locus tagO3K_04415
StrainEscherichia coli O104:H4 str. 2011C-3493
Repliconchromosome [GenBank: NC_018658] [Browse all T6SS(s) in this replicon]
Location [Strand]897849..899261 [+]
Producthypothetical protein
NoteTssK
UniProt IDK0AI00
KEGG IDesl:O3K_04415
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 3.30E-64, Aligned region: 20..446
Protein Sequence: 470 a.a.     [Download]
>gi|407480461|ref|YP_006777610.1| hypothetical protein O3K_04415 [Escherichia coli O104:H4 str. 2011C-3493]
MQEEEQLVYWYSGLYLQPQHFQSIDLHHGFMLARSRQLSQPHHQGYYECCINDDLLKEDTVRVEKIKAVL
SSGYYIEYPGNCVVQDKCLTNLKGSDHGTVDLWLALKRFNSGHKNVSSVNDKRGSARWISSDDERNMRNV
YHDSQDADITRIKYDIQILTDEEKDNTTDYEYLPLTRIIYGNNSLCIDDECSFPVMRLSANHKLRNKIAE
IYSDIKFYKNRLEKYRYTERTVSDGHLYNFLILCAINRTLPLLSSFINEDAIHPWLYYMALCQFAGEIST
FHNSGLSDTRIVELSYNHYEQISCFSDLQYYIKLILDDSCRDKIISVEFRKITTDTLICNFDEYGAGSNS
DYYIKLTSDTFRKNKLIALPEIKIAPSEHIDMIIQHALPGIKFTVMDAVTSDLQVRENTIWLKIDKHSEL
WTLAQTQKRVAFYWSCSPDDLLVELVLSQEKYAVSRPKQDNGSFHPAVGR
 
Nucleotide Sequence: 1413 bp     [Download]
>gi|407479587|ref|NC_018658.1|:897849-899261 Escherichia coli O104:H4 str. 2011C-3493 chromosome, complete genome
ATGCAAGAAGAAGAACAACTTGTTTATTGGTATTCAGGGCTCTATTTACAACCTCAGCACTTTCAGTCAA
TTGACTTGCATCATGGCTTCATGCTTGCCAGAAGCAGGCAGTTATCACAACCCCATCATCAGGGGTACTA
TGAATGTTGTATCAATGATGATCTTCTTAAGGAAGATACTGTCAGAGTTGAAAAAATAAAGGCTGTTTTA
TCTTCAGGGTATTATATCGAGTATCCGGGTAACTGTGTGGTACAGGATAAGTGCCTGACAAATCTCAAAG
GTTCAGATCACGGTACCGTGGATTTGTGGCTTGCGCTTAAGAGATTCAATTCCGGTCATAAAAATGTCTC
CAGTGTTAATGATAAACGAGGCTCTGCCAGATGGATAAGTTCAGATGATGAACGTAACATGCGTAATGTT
TATCATGACAGTCAGGATGCCGATATTACAAGAATAAAATATGATATTCAGATTCTTACAGATGAGGAAA
AAGATAATACTACAGACTATGAGTATTTACCCCTGACAAGGATCATATATGGAAATAATTCATTATGTAT
TGATGATGAGTGTTCATTTCCCGTGATGAGGTTATCTGCGAATCACAAACTTAGAAATAAGATCGCAGAG
ATCTATTCGGATATTAAGTTCTACAAAAATAGACTGGAGAAATACAGATATACAGAACGAACAGTGTCCG
ATGGACATCTTTATAACTTTTTAATTCTATGTGCTATTAATAGGACATTACCACTTCTTTCTTCATTCAT
TAATGAAGATGCCATTCACCCATGGTTGTATTATATGGCATTATGTCAGTTTGCAGGGGAAATATCTACA
TTTCATAACTCTGGACTTTCAGATACTAGGATTGTCGAACTATCATACAATCATTATGAGCAGATCTCAT
GTTTCAGTGATCTGCAGTATTATATTAAGTTAATACTGGATGATTCATGTCGAGATAAGATTATTAGTGT
TGAATTCAGAAAAATAACTACTGATACATTGATCTGTAATTTCGATGAGTACGGTGCCGGAAGTAATTCA
GATTACTATATTAAGTTAACCTCAGATACCTTCAGAAAGAATAAGCTGATTGCATTGCCAGAGATTAAGA
TTGCTCCATCTGAACATATCGACATGATAATTCAGCATGCTCTTCCAGGAATCAAGTTTACAGTGATGGA
TGCCGTTACATCTGATTTGCAGGTAAGAGAGAATACAATCTGGTTAAAGATAGATAAACATTCAGAATTA
TGGACGTTAGCTCAGACTCAAAAAAGAGTTGCATTCTATTGGTCATGTAGTCCTGATGATTTACTTGTAG
AGTTAGTATTATCGCAGGAAAAGTATGCCGTAAGCAGGCCTAAACAGGATAACGGTTCTTTCCATCCGGC
GGTTGGCAGATAA