SecReT6
Protein ID: 407483599
SecReT6 ID702
T6SS typei1
Gene symbol-
Locus tagO3K_20420
StrainEscherichia coli O104:H4 str. 2011C-3493
Repliconchromosome [GenBank: NC_018658] [Browse all T6SS(s) in this replicon]
Location [Strand]4190652..4190876 [+]
Producthypothetical protein
NoteTssC
UniProt IDK0ATD1
KEGG IDesl:O3K_20420
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 0.0011, Aligned region: 39..71
Protein Sequence: 74 a.a.     [Download]
>gi|407483599|ref|YP_006780748.1| hypothetical protein O3K_20420 [Escherichia coli O104:H4 str. 2011C-3493]
MTAHKNISGTYHLSVADILQVVYQVCFSPSVEINQDGVAALITTLDRRISDLLDEIIHFCEFQQSASHWQ
RVLH
 
Nucleotide Sequence: 225 bp     [Download]
>gi|407479587|ref|NC_018658.1|:4190652-4190876 Escherichia coli O104:H4 str. 2011C-3493 chromosome, complete genome
ATGACGGCACACAAAAATATCTCCGGGACATACCACCTCTCTGTTGCAGACATTCTGCAGGTGGTTTACC
AGGTATGTTTCAGCCCGTCCGTTGAAATCAACCAGGATGGTGTGGCTGCGCTGATTACAACACTGGATCG
CCGTATCAGTGATCTATTGGATGAGATTATCCATTTTTGTGAGTTTCAGCAGAGCGCGTCGCACTGGCAG
CGCGTACTTCACTGA