SecReT6
Protein ID: 407483600
SecReT6 ID702
T6SS typei1
Gene symbol-
Locus tagO3K_20425
StrainEscherichia coli O104:H4 str. 2011C-3493
Repliconchromosome [GenBank: NC_018658] [Browse all T6SS(s) in this replicon]
Location [Strand]4190927..4192402 [+]
Producthypothetical protein
NoteTssC
UniProt IDK0AQ81
KEGG IDesl:O3K_20425
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 3.20E-188, Aligned region: 68..489
Protein Sequence: 491 a.a.     [Download]
>gi|407483600|ref|YP_006780749.1| hypothetical protein O3K_20425 [Escherichia coli O104:H4 str. 2011C-3493]
MSLQEEELVSSHAGQPEQASSLLDQIMAQTRIQPGSEGYDVARQGVTAFIASILQSTASAEPVNKLAVDS
MIADIDERISRQMDVIIHAPAFQQVESFWRSLKTMVDRVDFRENIKVNVLHVTKQELLEDFEFAPEIIQS
GFYKHVYSSGFGQFGGEPIAAVLGAYEFKNTAPDMKLLQYVSAVGAMAHAPFLSSVSPEFMGLNSWTELP
NIKDLYAIFEGPAYTKWRALRDSEDSRYLGLTAPRFLLRQPYSPTDNPVKNFNYYEDVSQNHEDYLWGNT
AWMLACNIADSFAKYRWCPNIIGPQSGGAVKDLPVHLFETMGQIQAKIPTEVLVTDRREFELAEEGFITL
TMRKDSDNAAFFSANSVQKPKHFPGKDAETNYKLGTQLPYLFIINRLAHYIKVLQREQLGSWKERSDLER
ELNTWIRQYVADQENPPADVRSRKPLRAAKVEVMDVEGEPGWYQVALSVRPHFKFMGANFELSLVGRLDR
E
 
Nucleotide Sequence: 1476 bp     [Download]
>gi|407479587|ref|NC_018658.1|:4190927-4192402 Escherichia coli O104:H4 str. 2011C-3493 chromosome, complete genome
ATGTCTTTACAGGAAGAGGAACTCGTATCCAGTCATGCCGGGCAGCCTGAGCAGGCATCGTCGCTGCTTG
ATCAAATCATGGCACAGACCCGTATTCAGCCCGGTTCGGAAGGTTATGACGTTGCCCGCCAGGGTGTGAC
AGCCTTTATTGCCAGCATCCTGCAATCCACTGCATCTGCCGAACCGGTCAATAAACTGGCCGTGGACAGC
ATGATTGCAGATATTGATGAACGCATCAGCCGCCAGATGGATGTCATCATCCATGCGCCTGCCTTTCAGC
AGGTCGAGTCGTTCTGGCGCTCACTGAAAACCATGGTGGATCGCGTTGATTTCCGTGAAAACATCAAGGT
CAACGTGCTTCATGTCACCAAGCAGGAACTTCTGGAAGACTTTGAGTTTGCGCCAGAAATTATTCAGTCC
GGATTTTATAAGCACGTTTATTCGTCCGGTTTCGGACAGTTTGGCGGTGAACCCATCGCTGCCGTGCTGG
GCGCTTATGAGTTCAAAAATACCGCGCCTGACATGAAACTGCTGCAATACGTCAGTGCCGTGGGCGCAAT
GGCGCACGCACCGTTCCTGTCCTCCGTTTCCCCGGAGTTTATGGGGCTGAACTCGTGGACCGAACTGCCT
AATATCAAAGATCTTTATGCCATCTTTGAAGGTCCGGCCTACACCAAATGGCGCGCCCTGCGTGACTCGG
AAGATTCGCGCTATTTAGGGCTTACGGCACCCCGCTTCCTGCTTCGCCAGCCCTATTCACCAACAGATAA
CCCTGTTAAGAACTTTAACTATTACGAAGATGTCAGCCAGAACCACGAAGATTATCTGTGGGGTAATACG
GCCTGGATGCTGGCATGCAATATCGCAGACAGTTTTGCCAAATACCGCTGGTGTCCAAACATTATCGGTC
CGCAAAGCGGCGGCGCAGTGAAAGATCTGCCGGTGCATCTGTTCGAAACGATGGGGCAGATTCAGGCCAA
AATCCCAACCGAGGTGCTGGTCACCGATCGCCGCGAATTTGAACTGGCTGAAGAGGGTTTTATCACCCTT
ACCATGCGTAAAGACTCTGATAATGCAGCCTTTTTCTCTGCAAACTCGGTACAAAAACCGAAGCACTTTC
CGGGAAAAGATGCAGAAACCAACTATAAGCTGGGTACGCAGCTTCCTTATCTCTTCATCATCAATCGGTT
AGCGCACTACATCAAGGTGTTGCAGCGTGAACAACTGGGGTCATGGAAAGAAAGGAGCGACTTAGAAAGA
GAGCTTAATACCTGGATCCGTCAGTATGTTGCCGACCAGGAAAACCCGCCTGCAGACGTGCGCAGCCGCA
AACCTCTGCGCGCTGCCAAAGTTGAGGTTATGGATGTAGAAGGCGAACCCGGCTGGTACCAGGTTGCGCT
AAGCGTGAGACCTCATTTTAAATTTATGGGGGCAAATTTTGAGCTTTCCCTGGTTGGCCGGTTAGACAGG
GAGTAA