SecReT6
Protein ID: 407483601
SecReT6 ID702
T6SS typei1
Gene symbol-
Locus tagO3K_20430
StrainEscherichia coli O104:H4 str. 2011C-3493
Repliconchromosome [GenBank: NC_018658] [Browse all T6SS(s) in this replicon]
Location [Strand]4192409..4192822 [+]
Producthypothetical protein
NoteTssE
UniProt IDK0AS29
KEGG IDesl:O3K_20430
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 3.00E-18, Aligned region: 31..118
Protein Sequence: 137 a.a.     [Download]
>gi|407483601|ref|YP_006780750.1| hypothetical protein O3K_20430 [Escherichia coli O104:H4 str. 2011C-3493]
MIPDRERTTGSLFERMEASSARNRQGGSIYSLRQSIRQNLRNILNTRSGSCRGAPELGIDEPEGAENFRE
SMSRAIEQCIERYEPRISHAEVQAVVSSASSPLDMTFHITAWVTFNETHEVLEFDMAPNGSQHYRVD
 
Nucleotide Sequence: 414 bp     [Download]
>gi|407479587|ref|NC_018658.1|:4192409-4192822 Escherichia coli O104:H4 str. 2011C-3493 chromosome, complete genome
ATGATACCGGATCGGGAAAGAACCACAGGTTCTCTTTTTGAGCGTATGGAAGCCTCTTCGGCCAGAAACC
GGCAGGGAGGCAGTATTTATTCGCTCAGGCAATCCATTCGCCAGAACCTACGAAACATTCTTAATACCCG
GTCCGGTAGTTGCCGGGGTGCGCCTGAGCTGGGCATTGATGAACCGGAAGGGGCTGAAAACTTCCGCGAA
TCCATGAGTCGGGCCATCGAGCAATGTATAGAACGCTATGAACCCCGGATCTCACACGCTGAAGTGCAGG
CAGTGGTTTCATCCGCCTCCAGCCCGCTGGATATGACGTTTCATATTACAGCCTGGGTGACATTTAACGA
AACGCATGAGGTGCTTGAATTTGATATGGCACCGAATGGCAGCCAGCATTACCGGGTGGACTGA