SecReT6
Protein ID: 407483605
SecReT6 ID702
T6SS typei1
Gene symbol-
Locus tagO3K_20450
StrainEscherichia coli O104:H4 str. 2011C-3493
Repliconchromosome [GenBank: NC_018658] [Browse all T6SS(s) in this replicon]
Location [Strand]4197024..4197548 [+]
Productlipoprotein
NoteTssJ
UniProt IDK0AQ84
KEGG IDesl:O3K_20450
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 8.00E-33, Aligned region: 13..167
Protein Sequence: 174 a.a.     [Download]
>gi|407483605|ref|YP_006780754.1| lipoprotein [Escherichia coli O104:H4 str. 2011C-3493]
MNRKAFLACVLMCVILTGCETAKKISEVIKNPDIQVGSLKEQPSEITVTLLTEPDTNTNAEGESAAVDVQ
LVYLTDDSKLLAADYDQIASTPLPDVLGKNYIDHQDFNLLPDTIKTLPPVKLDEKTQFIGVVAYFSDDQA
TEWKQIETVEGTGHHYRLLVHVRQSSIEMKKEDE
 
Nucleotide Sequence: 525 bp     [Download]
>gi|407479587|ref|NC_018658.1|:4197024-4197548 Escherichia coli O104:H4 str. 2011C-3493 chromosome, complete genome
ATGAACAGGAAGGCGTTTCTGGCCTGCGTGCTGATGTGCGTCATATTAACCGGCTGCGAAACGGCGAAAA
AAATCAGTGAGGTGATCAAAAACCCGGATATCCAGGTCGGGAGCCTGAAGGAGCAACCTTCGGAAATAAC
CGTCACCCTGCTGACCGAACCGGACACCAATACCAATGCGGAAGGTGAATCAGCCGCCGTGGATGTGCAA
CTGGTGTACCTGACTGACGACTCAAAATTGCTGGCAGCCGACTATGACCAGATAGCCAGTACGCCGCTAC
CGGATGTGCTGGGTAAAAACTATATCGACCACCAGGATTTCAACCTGTTGCCGGACACCATCAAAACCCT
GCCGCCGGTAAAGCTGGATGAGAAAACGCAGTTTATTGGTGTCGTGGCCTATTTCTCCGATGACCAGGCC
ACTGAATGGAAACAAATCGAGACGGTGGAAGGAACCGGCCACCATTACCGCCTGCTGGTGCATGTACGTC
AAAGCAGCATCGAAATGAAAAAAGAGGATGAATAA