SecReT6
Protein ID: 407483610
SecReT6 ID702
T6SS typei1
Gene symbol-
Locus tagO3K_20475
StrainEscherichia coli O104:H4 str. 2011C-3493
Repliconchromosome [GenBank: NC_018658] [Browse all T6SS(s) in this replicon]
Location [Strand]4203161..4204576 [+]
Producthypothetical protein
NoteTssA
UniProt IDK0AQ87
KEGG IDesl:O3K_20475
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 1.80E-07, Aligned region: 54..111
ImpA-rel_N [PF06812], Evalue: 1.80E-07, Aligned region: 152..186
Protein Sequence: 471 a.a.     [Download]
>gi|407483610|ref|YP_006780759.1| hypothetical protein O3K_20475 [Escherichia coli O104:H4 str. 2011C-3493]
MAMDLRDPNVWVSHLLENLPEEKLASALKDDNPDWEYIDGGIVKLGSLAHSQLDIPELQHRGLVLLASES
KDFRLLAHLLRTLQHAGDPLLALRLLALYVEHYWAVAAPQNMAHKKRFASQVIKRFETGIDAFSQNAATA
QRDALLGELAKLAQCWQSHNAPELAQATDDLFALYQRAFNRAAPAPAPTPAASSSSPQTIATSESGVTHT
STPTPQIAIDSHDDKTWRDTLLKVAAILCERQPESPQGYRLRRHALWLTITSTPQAKSDRRTPLAAVSAD
MVADYQSRLASADMELWQQVEKSVLLAPYWLDGHYISAQTAHRLGYTAVADAIRDEVVSFLGRLPALADL
LFNDHTPFVSEKTKQWLANQPGNQSAPVIQVSNEDIQAARLCFDEQGLEAALRYLDTLPAGEPRDQFHRQ
YFGAQLMEEAGLVQLAQQQYRMLFRMGLQMMVADWEPSLLEQLEQKFTAEQ
 
Nucleotide Sequence: 1416 bp     [Download]
>gi|407479587|ref|NC_018658.1|:4203161-4204576 Escherichia coli O104:H4 str. 2011C-3493 chromosome, complete genome
ATGGCAATGGACTTACGCGATCCGAATGTCTGGGTATCGCACCTGCTGGAAAACCTGCCGGAAGAGAAAC
TGGCATCGGCGCTGAAGGACGACAACCCGGACTGGGAGTATATCGACGGTGGGATTGTCAAACTGGGATC
GCTGGCGCACAGCCAGCTGGATATCCCTGAACTCCAGCACCGGGGACTGGTCCTTCTGGCTTCGGAGAGT
AAGGATTTTCGCCTGCTGGCGCATCTGCTGAGAACCCTGCAACATGCCGGTGATCCGCTCCTGGCCTTGC
GCCTGCTGGCGCTGTATGTGGAGCATTACTGGGCGGTAGCCGCGCCGCAGAATATGGCACATAAAAAACG
CTTTGCCAGCCAGGTTATTAAACGCTTCGAAACAGGTATTGACGCTTTTTCACAGAACGCCGCCACAGCG
CAGCGCGATGCGCTGCTAGGTGAACTGGCGAAACTGGCGCAATGCTGGCAGTCACATAATGCCCCGGAAC
TAGCACAGGCTACTGATGATCTTTTTGCCCTTTACCAGCGTGCGTTTAATCGTGCGGCACCGGCTCCAGC
CCCCACTCCGGCGGCCTCCAGTAGTTCACCACAGACGATCGCCACGTCTGAAAGCGGCGTGACGCATACC
AGTACTCCGACTCCACAGATCGCCATCGACAGTCACGACGACAAAACCTGGCGCGACACACTGTTAAAAG
TGGCGGCCATTTTATGCGAGCGCCAACCGGAATCGCCGCAGGGCTATCGCCTGCGTCGCCATGCCCTGTG
GCTAACCATCACCAGTACGCCCCAGGCGAAAAGCGATAGACGTACTCCACTGGCTGCGGTCTCTGCCGAT
ATGGTGGCGGATTACCAGTCCCGGCTTGCCAGCGCGGATATGGAGCTGTGGCAGCAGGTGGAAAAAAGCG
TACTGCTGGCACCCTACTGGCTGGACGGTCACTACATTTCTGCACAGACGGCGCACCGTCTTGGTTATAC
CGCTGTAGCCGATGCCATCCGCGATGAAGTCGTTTCCTTTCTTGGCCGTCTGCCCGCGCTCGCTGATCTT
CTGTTTAACGACCACACACCGTTTGTTTCTGAAAAAACGAAGCAATGGCTTGCAAATCAGCCAGGTAACC
AGTCCGCGCCAGTCATACAGGTGAGTAATGAAGATATTCAGGCTGCGCGGTTGTGTTTTGATGAGCAGGG
GCTGGAAGCCGCCTTACGGTATCTGGATACGTTACCCGCCGGTGAACCCCGCGACCAGTTCCACCGGCAG
TATTTTGGCGCGCAGCTTATGGAAGAGGCGGGGCTGGTACAGCTTGCGCAACAGCAGTACAGGATGTTGT
TCAGGATGGGATTGCAGATGATGGTGGCAGACTGGGAGCCGTCCCTGCTTGAGCAGCTAGAACAAAAATT
CACGGCAGAACAATAA