SecReT6
Protein ID: 407483612
SecReT6 ID702
T6SS typei1
Gene symbol-
Locus tagO3K_20485
StrainEscherichia coli O104:H4 str. 2011C-3493
Repliconchromosome [GenBank: NC_018658] [Browse all T6SS(s) in this replicon]
Location [Strand]4208130..4209482 [+]
Producthypothetical protein
NoteTssA
UniProt IDK0ATF6
KEGG IDesl:O3K_20485
PDB IDNA
Domain hit(s) vs Pfam DUF3702 [PF12486], Evalue: 8.40E-44, Aligned region: 139..154
DUF3702 [PF12486], Evalue: 8.40E-44, Aligned region: 292..436
ImpA-rel_N [PF06812], Evalue: 1.00E-20, Aligned region: 41..100
ImpA-rel_N [PF06812], Evalue: 1.00E-20, Aligned region: 248..264
Protein Sequence: 450 a.a.     [Download]
>gi|407483612|ref|YP_006780761.1| hypothetical protein O3K_20485 [Escherichia coli O104:H4 str. 2011C-3493]
MNSNVLTQTIVTGSDPRGLPEFSAIREEINKASHPSQPELNWKLVESLALAIFKANGVDLHTATYYTLAR
TRTQGLAGFCEGAELLAAMVSHDWDKFWPQGGPARTEMLDWFNSRTGNILRQQISFAESDLPLIYRTERA
LQLICDKLQQVELKRVPRVENLLYFMQNTRKRLEPQLKSNTENAAQTTVRTLIYAPETQASSTPEAVVPP
LPGLPEMKVEVRSLTENPPQASVIKQGSTVRGFIAGIACSVAVASALWWWQVYPVQQQLLQVNDTAQGAA
TVWMASPELENYERRLQQLLDTSPVQPLETGMQMMRVADSRWPESLQQQQASTQWNEALKTRAQSSPQLR
GWLQTRQDLHAFADLVMQREKEGLTLSYIKNVIWQAERGLGQETPVESLLTQYHDARAQKQNTDALEKQI
NERLEGVLSRWLLLKNNVMPEAATGTTAEK
 
Nucleotide Sequence: 1353 bp     [Download]
>gi|407479587|ref|NC_018658.1|:4208130-4209482 Escherichia coli O104:H4 str. 2011C-3493 chromosome, complete genome
ATGAATAGTAACGTACTGACACAAACTATCGTTACCGGCAGTGACCCGCGCGGGCTGCCGGAATTCAGCG
CCATCCGCGAGGAAATAAACAAAGCCAGCCACCCGTCACAGCCTGAGCTGAACTGGAAACTGGTGGAGTC
GCTGGCGCTGGCGATTTTTAAAGCCAACGGTGTGGATTTACACACCGCCACCTACTATACGCTTGCCCGG
ACACGGACACAGGGACTGGCGGGATTCTGCGAAGGTGCGGAACTGCTGGCGGCAATGGTAAGCCACGACT
GGGATAAGTTCTGGCCGCAGGGCGGCCCGGCGCGTACTGAAATGCTGGACTGGTTTAACTCCCGAACCGG
CAATATTCTGCGTCAGCAAATCTCCTTTGCGGAATCCGACCTACCACTGATCTACCGCACAGAGCGGGCA
TTGCAGCTTATCTGCGATAAGCTCCAGCAGGTGGAACTGAAGCGCGTTCCGCGCGTGGAGAATCTGCTCT
ATTTTATGCAGAACACGCGTAAACGGCTTGAACCCCAGCTGAAGAGTAACACTGAGAACGCCGCACAGAC
CACGGTCAGAACGCTGATTTATGCCCCGGAAACACAGGCATCTTCCACACCAGAAGCGGTAGTGCCTCCC
CTGCCCGGCCTGCCTGAGATGAAAGTGGAAGTGCGCAGTCTGACAGAGAATCCCCCACAGGCCAGTGTGA
TAAAGCAAGGCAGTACGGTAAGAGGGTTTATCGCAGGGATCGCCTGTTCAGTGGCTGTCGCCTCAGCATT
GTGGTGGTGGCAGGTCTATCCGGTGCAGCAGCAACTGTTACAGGTTAACGACACCGCTCAGGGCGCAGCA
ACGGTGTGGATGGCCTCACCTGAACTCGAAAACTATGAGCGCAGGCTGCAACAACTTCTTGATACCTCCC
CGGTACAGCCGCTGGAAACCGGGATGCAGATGATGCGTGTTGCCGACAGTCGCTGGCCGGAAAGCCTGCA
ACAGCAACAGGCCTCGACACAATGGAATGAGGCACTCAAAACCCGCGCACAGAGTAGCCCGCAGTTGCGT
GGCTGGTTGCAGACCCGCCAGGACTTACATGCTTTTGCAGATCTAGTGATGCAGCGCGAGAAAGAGGGAC
TAACCCTTTCCTATATCAAAAATGTCATCTGGCAGGCGGAGCGGGGACTGGGGCAGGAAACACCCGTTGA
GTCTCTGTTGACGCAGTACCATGATGCCCGTGCGCAGAAGCAGAATACAGATGCGCTGGAAAAACAAATT
AATGAGCGACTCGAAGGCGTGTTAAGCCGCTGGCTGCTGCTGAAGAATAACGTCATGCCAGAGGCGGCAA
CCGGTACCACGGCCGAAAAATAA