SecReT6
Protein ID: 407696011
SecReT6 ID706
T6SS typei4b
Gene symbol-
Locus tagB5T_02182
StrainAlcanivorax dieselolei B5
Repliconchromosome [GenBank: NC_018691] [Browse all T6SS(s) in this replicon]
Location [Strand]2390729..2392021 [+]
ProductRhs element Vgr protein
NotePAAR
UniProt IDK0CFQ6
KEGG IDadi:B5T_02182
PDB IDNA
Domain hit(s) vs Pfam PAAR_motif [PF05488], Evalue: 1.30E-23, Aligned region: 8..83
DUF4157 [PF13699], Evalue: 0.0013, Aligned region: 114..131
DUF4157 [PF13699], Evalue: 0.0013, Aligned region: 241..314
Protein Sequence: 430 a.a.     [Download]
>gi|407696011|ref|YP_006820799.1| Rhs element Vgr protein [Alcanivorax dieselolei B5]
MSRPIIVLGDKTDHDGTVIGASTTTDIDGKGVARVGDKVICPKHGPSPIITTIATGDPTNLVDGQPVARH
GDKTACGATLISSQAASVVDAGGGKKGIDLGAVAAGLATVVGVSAAVIGARASRYDEQIRFVNAKGAPLA
GVNYRLEMDDGSVVEGETDDDGRSRRIETDQPSKVVKATLSSSQPECCGDQRHGHEASSLEVDVGNVTTS
DQQVGSSVATVATPEGESRGLTSGEIAMARRIFGDSIDYGRVRVHNGEYLWFGLQPNDTAMTPNGEMYFN
PDRFREDFSPPANSYHRDQAWFMHEMTHVWQYQLGYPVKWKRGNPLGWIMSYKYKVDPAKRFSDYNMEEQ
GDIIRDYFSLKILRNRHVVVQEEYRRLDHLPDLESILVDFLKQPADVRHLPGGGKPGRDDRREERGLERA
EAFPDQGDDE
 
Nucleotide Sequence: 1293 bp     [Download]
>gi|407693844|ref|NC_018691.1|:2390729-2392021 Alcanivorax dieselolei B5 chromosome, complete genome
ATGTCACGGCCGATCATAGTACTGGGTGACAAAACCGACCATGATGGCACCGTCATTGGCGCCTCCACCA
CCACCGATATCGACGGCAAGGGCGTGGCCCGGGTCGGCGACAAGGTCATCTGCCCCAAGCACGGCCCTTC
CCCCATCATCACCACCATTGCCACTGGCGACCCCACCAATCTGGTCGATGGCCAGCCCGTGGCCCGTCAT
GGCGATAAAACCGCCTGCGGCGCGACCCTGATTTCCAGCCAGGCGGCGTCCGTGGTGGACGCCGGCGGCG
GCAAAAAAGGCATCGACCTCGGCGCGGTGGCCGCCGGCCTCGCCACGGTCGTGGGCGTTTCCGCCGCGGT
CATCGGTGCCCGGGCCTCTCGATACGATGAGCAGATACGCTTCGTCAACGCCAAGGGTGCCCCCCTGGCC
GGGGTGAACTATCGCCTGGAAATGGACGATGGCAGCGTGGTCGAAGGGGAAACCGATGACGACGGACGCA
GCCGTCGTATTGAAACCGACCAGCCGAGCAAGGTGGTCAAGGCGACGCTTTCCTCCTCACAGCCGGAGTG
CTGCGGTGATCAACGGCACGGGCATGAGGCATCCAGTCTGGAGGTCGACGTGGGCAACGTAACCACCAGC
GATCAGCAGGTGGGAAGCTCGGTGGCCACCGTGGCCACGCCGGAAGGTGAGTCACGAGGGCTGACCTCCG
GGGAAATCGCCATGGCCCGGCGGATATTTGGTGATTCCATCGACTACGGCCGGGTCCGCGTCCATAACGG
TGAATATTTGTGGTTTGGGCTGCAGCCCAACGATACGGCAATGACCCCTAATGGAGAGATGTATTTCAAT
CCTGACCGATTTCGGGAGGACTTTTCTCCTCCGGCTAATTCTTACCATAGAGATCAGGCCTGGTTCATGC
ATGAAATGACCCATGTTTGGCAGTACCAACTGGGCTATCCGGTTAAGTGGAAACGCGGAAATCCGCTCGG
CTGGATTATGTCGTACAAATACAAGGTGGACCCAGCCAAACGCTTTTCTGACTACAACATGGAAGAGCAG
GGTGACATCATTCGCGATTACTTTTCGCTGAAAATTCTTAGGAACCGCCATGTCGTCGTGCAGGAAGAGT
ATCGGCGCCTGGACCATTTGCCGGATCTGGAAAGCATCTTGGTGGATTTTTTGAAGCAGCCCGCTGATGT
TCGCCACTTGCCCGGTGGTGGAAAACCCGGACGGGACGACAGGCGAGAAGAGCGTGGTTTGGAGAGGGCT
GAGGCCTTTCCTGATCAAGGAGATGATGAATGA