SecReT6
Protein ID: 407696016
SecReT6 ID706
T6SS typei4b
Gene symbol-
Locus tagB5T_02187
StrainAlcanivorax dieselolei B5
Repliconchromosome [GenBank: NC_018691] [Browse all T6SS(s) in this replicon]
Location [Strand]2398698..2399483 [+]
Productouter membrane protein-related peptidoglycan-associated (lipo)protein
NoteTagL
UniProt IDK0CFR1, K0CFR1
KEGG IDadi:B5T_02187
PDB IDNA
Domain hit(s) vs Pfam OmpA [PF00691], Evalue: 1.30E-22, Aligned region: 103..140
OmpA [PF00691], Evalue: 1.30E-22, Aligned region: 159..254
BON [PF04972], Evalue: 9.60E-05, Aligned region: 36..71
BON [PF04972], Evalue: 9.60E-05, Aligned region: 100..124
Protein Sequence: 261 a.a.     [Download]
>gi|407696016|ref|YP_006820804.1| outer membrane protein-related peptidoglycan-associated (lipo)protein [Alcanivorax dieselolei B5]
MSWRKGVLMLLCGALMQVSFAQEAEEVPEKPALPPVVAKGVVPDQATRAAVLERLHEIYGAERVVDRIQV
EAVPAPPNWGQYVANMLSPELKSIRGGEINIEGQSVRITGEVDNEAQRQRVASALSMASSRDYTVTNSLR
LGESRQQRLDDTLADRLIRFQSGSDQLTVDGRRILDEMAEVMRDMGDAHVQIIGHTDNVGRRQNNVALSY
ARADAVRRYLIEQGVREDGLGVVGKGPDEPVADNATPEGRARNRRIEFRIL
 
Nucleotide Sequence: 786 bp     [Download]
>gi|407693844|ref|NC_018691.1|:2398698-2399483 Alcanivorax dieselolei B5 chromosome, complete genome
ATGAGCTGGCGCAAAGGGGTATTGATGTTGCTGTGCGGCGCCTTGATGCAAGTGTCGTTCGCGCAGGAGG
CGGAGGAGGTTCCGGAGAAGCCTGCGTTGCCACCAGTGGTGGCCAAGGGCGTGGTCCCGGATCAGGCTAC
CCGGGCGGCGGTGTTGGAACGTCTGCACGAGATTTACGGCGCCGAAAGGGTGGTGGATCGCATCCAGGTG
GAAGCGGTGCCCGCCCCGCCGAATTGGGGCCAGTACGTGGCCAATATGTTGTCGCCGGAACTTAAATCAA
TTCGCGGCGGCGAGATCAATATCGAAGGCCAGAGCGTCCGCATCACCGGTGAAGTGGATAACGAAGCTCA
GCGCCAGCGCGTGGCCAGTGCCTTGAGTATGGCGAGCAGCCGGGATTACACGGTGACCAACAGTTTGCGG
CTCGGTGAGTCCCGCCAGCAACGCCTGGACGATACTCTGGCGGATCGCTTGATCCGGTTTCAGAGCGGCA
GTGACCAGCTGACGGTTGACGGGCGGCGCATCCTCGATGAGATGGCCGAGGTGATGCGCGATATGGGAGA
CGCCCATGTCCAGATTATTGGTCATACGGATAATGTCGGCCGCCGTCAGAACAATGTGGCGTTGAGCTAT
GCCAGGGCCGACGCGGTGCGCCGTTACCTGATCGAGCAGGGCGTGCGGGAAGATGGTCTGGGGGTGGTCG
GCAAGGGGCCGGATGAGCCGGTGGCGGACAATGCCACGCCCGAAGGGCGGGCGCGCAACCGGCGCATCGA
ATTCCGCATTCTCTGA