SecReT6
Protein ID: 407696017
SecReT6 ID706
T6SS typei4b
Gene symbol-
Locus tagB5T_02188
StrainAlcanivorax dieselolei B5
Repliconchromosome [GenBank: NC_018691] [Browse all T6SS(s) in this replicon]
Location [Strand]2399503..2400546 [-]
Productprotein ImpA
NoteTssA
UniProt IDK0CFG5
KEGG IDadi:B5T_02188
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 5.40E-24, Aligned region: 54..114
Protein Sequence: 347 a.a.     [Download]
>gi|407696017|ref|YP_006820805.1| protein ImpA [Alcanivorax dieselolei B5]
MDHWQDLISPIRDDAPAGDDLSFSMEFDAIQEARRADDPTLDQGEWVTDIKYADWPGAAKLCRELLQNRT
KDLRVASWLTEANTQLHGFAGLAGGYRLIAYFCDHYWDTVYPMMDQGDTEERVGNLVWLLTQSQQWLRTL
PLVNSPQGRFGLNDFETVFSRAENAEQDPGAHPDQDQLQAARRDTSADYYRRLLEEIPDCGAALRELRDA
VDRHLGVDGPSFSAAEDLLTLLNQTARRFARDANVDVPGDDTEVGIGDPNPPIVSATPAASPGGPIQSRQ
QALEQLRDVAAFFRRTEPHSPVAYLAERAARWGEMPLHQWLKTVIKDDGILSQVEELLDVERDQDMN
 
Nucleotide Sequence: 1044 bp     [Download]
>gi|407693844|ref|NC_018691.1|:c2400546-2399503 Alcanivorax dieselolei B5 chromosome, complete genome
ATGGATCATTGGCAAGACCTGATCAGCCCAATTCGAGATGACGCCCCCGCCGGTGACGACCTGTCCTTTT
CGATGGAATTCGATGCCATTCAGGAAGCCAGGCGCGCCGACGATCCGACTCTGGATCAGGGGGAATGGGT
CACCGATATCAAATACGCGGACTGGCCGGGCGCCGCCAAACTGTGTCGCGAGTTACTACAGAATCGCACC
AAGGATTTACGGGTGGCGTCCTGGCTCACCGAAGCCAATACCCAGTTGCATGGATTCGCCGGGCTGGCCG
GCGGCTATCGCCTGATCGCCTATTTCTGTGATCATTATTGGGACACTGTGTACCCGATGATGGACCAGGG
CGACACCGAAGAAAGGGTGGGCAATCTGGTCTGGCTGCTGACTCAGTCGCAGCAGTGGCTGCGCACCCTG
CCCCTGGTGAATTCGCCTCAGGGGCGCTTCGGGCTTAATGATTTCGAGACGGTGTTTTCCCGGGCGGAAA
ATGCCGAGCAGGATCCCGGCGCCCATCCGGACCAGGATCAGTTGCAGGCGGCCCGGCGGGACACTTCAGC
GGATTACTATCGGCGCCTGCTTGAGGAAATCCCCGACTGCGGCGCCGCGCTACGCGAGTTGCGGGATGCG
GTGGACCGGCATCTGGGCGTGGATGGCCCCAGCTTCAGCGCCGCCGAGGATCTGCTGACCCTGTTGAATC
AAACCGCCCGTCGCTTTGCCCGGGATGCCAATGTGGACGTTCCCGGCGACGACACCGAGGTCGGTATTGG
CGATCCCAATCCTCCGATCGTTTCCGCCACACCGGCGGCCAGCCCTGGCGGCCCGATCCAATCACGACAA
CAGGCACTGGAACAGCTGCGGGACGTGGCGGCGTTCTTTCGCCGCACCGAACCGCACAGCCCAGTGGCCT
ACCTGGCCGAACGCGCCGCCCGTTGGGGCGAGATGCCTCTGCATCAATGGCTGAAAACGGTGATCAAGGA
CGACGGCATACTGTCGCAGGTGGAAGAATTGCTGGATGTGGAGCGGGATCAGGACATGAACTGA