SecReT6
Protein ID: 407696018
SecReT6 ID706
T6SS typei4b
Gene symbol-
Locus tagB5T_02189
StrainAlcanivorax dieselolei B5
Repliconchromosome [GenBank: NC_018691] [Browse all T6SS(s) in this replicon]
Location [Strand]2400578..2401369 [-]
Producttransmembrane protein
NoteTssL
UniProt IDK0CD29
KEGG IDadi:B5T_02189
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 2.40E-54, Aligned region: 33..234
Protein Sequence: 263 a.a.     [Download]
>gi|407696018|ref|YP_006820806.1| transmembrane protein [Alcanivorax dieselolei B5]
MTEGPSLSARPSLTGAAPADAGTAPRDTVAGGRLLDLMFDGFYLLVLLKRGQLPSQADTFASEIQSFLEG
VERSAMKNSIASEDIYAAKYAFCAAVDEVILSQPTRLRDEWERHPLQLRLFGDHLAGQHFFDYLEDLRAQ
GAPRLASLEVYHYCLLLGFEGKYRLDGTEKLGYLIARLGDEIAYLKGQRSGFAPHWAPPDNVRHTLRRVV
PLWLPLMFLAGFAVLAFFGLRLTLNQQTETSLAAYQNIVQMPERTAHITITLP
 
Nucleotide Sequence: 792 bp     [Download]
>gi|407693844|ref|NC_018691.1|:c2401369-2400578 Alcanivorax dieselolei B5 chromosome, complete genome
ATGACCGAAGGCCCTTCTCTCTCCGCACGTCCTTCCCTGACCGGCGCCGCGCCAGCGGATGCCGGTACCG
CGCCACGGGATACCGTCGCTGGCGGACGCCTGCTGGACCTCATGTTTGACGGCTTCTATTTGCTGGTGCT
GCTGAAACGGGGCCAATTACCGAGTCAGGCCGACACCTTTGCCAGTGAGATTCAGAGCTTTCTGGAAGGG
GTGGAACGCAGCGCGATGAAAAACAGCATCGCTTCCGAAGACATCTATGCCGCCAAATACGCTTTCTGCG
CGGCGGTGGACGAAGTCATCCTTTCGCAACCCACCCGCCTCCGCGATGAATGGGAACGCCATCCGTTGCA
ACTGCGTCTGTTTGGCGATCATCTGGCGGGTCAGCATTTTTTTGATTATCTGGAAGATTTACGAGCCCAG
GGCGCGCCCAGGCTGGCCTCACTGGAGGTTTATCACTATTGCCTGCTGCTGGGGTTCGAAGGCAAGTACC
GGCTTGATGGCACCGAAAAGCTGGGTTACCTGATTGCCCGTCTTGGCGATGAGATTGCCTACCTGAAAGG
ACAACGCAGCGGCTTCGCCCCGCACTGGGCACCACCGGACAATGTCCGCCATACCCTCCGCCGGGTGGTA
CCGCTTTGGTTACCGTTGATGTTCCTGGCCGGCTTCGCGGTACTGGCGTTTTTCGGTTTGCGTCTGACCT
TGAATCAACAGACCGAAACCAGCCTGGCGGCTTACCAGAACATCGTGCAAATGCCGGAGCGCACCGCGCA
CATCACCATCACGCTGCCTTGA