SecReT6
Protein ID: 407696019
SecReT6 ID706
T6SS typei4b
Gene symbol-
Locus tagB5T_02190
StrainAlcanivorax dieselolei B5
Repliconchromosome [GenBank: NC_018691] [Browse all T6SS(s) in this replicon]
Location [Strand]2401366..2402712 [-]
Producthypothetical protein
NoteTssK
UniProt IDK0CA70
KEGG IDadi:B5T_02190
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 3.20E-132, Aligned region: 22..446
Protein Sequence: 448 a.a.     [Download]
>gi|407696019|ref|YP_006820807.1| hypothetical protein B5T_02190 [Alcanivorax dieselolei B5]
MSHVSRMSKVLWGEGLFLRPQHFQRQDTYHEARLHHVAQSLHPYPWGIRQIRLDQRALESGAVRILELSL
VFPDGEIYQAPDADALPDPLRLEELPAGVSSTVIHLALPLLKEHGGNCNDDGGNARFTQTLMGTTDLYTD
SAQAELTYLKKSVRLLTDDTPRDRYLTVPLLRVKRTSTGGFELDDSFMPPCLHLDASDYLSRQLRGLLDA
LQAKSEALGNQQRQASQGLIEFRSSDVASFWLLHTANTAYATLSHFFAQPKFHPERLYQELLRLAGNLLT
YSTQHSLADLPQYRHDAPDEAFAALFHLVRDLLDTVISTRHFAIPLAEIKPSYHRGMLDSQRIDAQTALY
LGVAADMPGQELVETVPVRFKVGAPDDVEKCVLAAMPGVKLIHASQIPAAIPVRPGSYYFSLEPRGPLYE
RMLKGQSVMVYVPTGVQDLKLELIAVTS
 
Nucleotide Sequence: 1347 bp     [Download]
>gi|407693844|ref|NC_018691.1|:c2402712-2401366 Alcanivorax dieselolei B5 chromosome, complete genome
GTGTCGCATGTCAGCCGCATGTCGAAGGTACTTTGGGGGGAAGGTCTGTTCCTCCGCCCACAGCATTTTC
AACGTCAGGACACTTACCACGAAGCGCGTCTTCATCATGTCGCGCAAAGCCTGCACCCCTACCCCTGGGG
CATTCGCCAAATCCGCCTGGACCAGCGCGCCCTTGAAAGTGGAGCCGTTCGTATTCTGGAACTGTCACTG
GTATTCCCGGACGGCGAAATTTACCAGGCACCCGATGCCGACGCTCTGCCCGATCCTTTACGTCTGGAAG
AACTCCCCGCCGGAGTGTCCAGCACGGTGATTCATCTGGCTCTGCCTCTGCTCAAGGAGCATGGCGGCAA
CTGCAATGACGATGGCGGCAACGCCCGCTTCACGCAGACGCTAATGGGGACCACCGATCTGTACACCGAT
TCCGCCCAGGCGGAGCTGACCTATCTGAAAAAGTCCGTGCGGCTGCTTACCGATGACACCCCGCGCGACC
GCTATCTGACCGTGCCTTTGTTGCGGGTCAAGCGCACCTCCACGGGCGGGTTCGAGTTGGACGACAGTTT
CATGCCGCCGTGCCTCCACCTGGACGCCTCGGATTATCTGTCTCGTCAGTTGCGTGGACTGCTGGATGCC
CTGCAGGCCAAATCCGAGGCCCTTGGCAATCAGCAACGCCAAGCCTCTCAGGGATTGATCGAATTTCGCT
CTTCGGACGTGGCGTCATTCTGGCTGTTGCATACCGCCAATACCGCCTACGCCACGCTGTCGCATTTCTT
CGCCCAGCCCAAATTCCACCCGGAACGGCTCTACCAGGAGTTACTGCGACTGGCCGGGAATCTGCTGACC
TACTCGACACAGCACAGCCTGGCGGATCTTCCCCAGTACCGTCACGACGCCCCGGATGAGGCCTTCGCGG
CGCTATTCCATCTGGTGCGGGATCTGCTCGACACAGTTATTTCCACTCGTCACTTCGCCATCCCGCTGGC
CGAAATCAAACCGTCTTATCATCGCGGCATGCTGGACTCTCAGCGGATTGACGCTCAGACCGCGCTTTAT
CTTGGCGTCGCCGCGGATATGCCCGGCCAGGAGCTGGTGGAAACGGTGCCGGTCCGGTTCAAAGTGGGCG
CGCCGGACGATGTGGAGAAATGCGTTCTGGCCGCCATGCCCGGGGTCAAGTTGATCCATGCCAGTCAGAT
TCCCGCCGCCATCCCGGTCCGTCCCGGCAGCTACTATTTTTCCCTGGAGCCCCGTGGCCCGCTGTACGAA
CGGATGCTCAAGGGACAATCGGTGATGGTCTATGTCCCCACCGGCGTACAGGACCTGAAACTTGAATTGA
TCGCGGTGACGTCATGA