SecReT6
Protein ID: 407696020
SecReT6 ID706
T6SS typei4b
Gene symbol-
Locus tagB5T_02191
StrainAlcanivorax dieselolei B5
Repliconchromosome [GenBank: NC_018691] [Browse all T6SS(s) in this replicon]
Location [Strand]2402846..2403430 [-]
Producttransmembrane protein
NoteTssJ
UniProt IDK0CDG4
KEGG IDadi:B5T_02191
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 6.90E-26, Aligned region: 27..160
Protein Sequence: 194 a.a.     [Download]
>gi|407696020|ref|YP_006820808.1| transmembrane protein [Alcanivorax dieselolei B5]
MYLPVPRCSVFLNQFTKNILLAALLIWLQGCALLGSDTPEETVIPVRLYGGDNLNAGTGYQAYSLVVRIY
HLRDTERFYQASLQDFLDDDAEARALRNDLISVSEVVLTPGAHHLIEARVPEQAKAIGVVGLFRSPARER
WRFAFDVTEKPVIKSGLTLGFHACAVTSNGTGLIRTPTGDPASLVAVRCPALPR
 
Nucleotide Sequence: 585 bp     [Download]
>gi|407693844|ref|NC_018691.1|:c2403430-2402846 Alcanivorax dieselolei B5 chromosome, complete genome
ATGTATCTCCCGGTTCCACGTTGTTCTGTTTTTTTGAACCAGTTCACAAAAAATATTCTCCTGGCCGCTT
TGCTGATATGGCTGCAAGGCTGCGCCCTGCTTGGTTCTGATACCCCCGAGGAAACCGTCATTCCGGTTCG
CCTCTATGGCGGCGACAATCTGAACGCCGGCACCGGTTATCAGGCCTACTCCCTGGTAGTACGAATTTAT
CACTTGCGCGACACCGAACGTTTTTACCAGGCGTCGTTGCAGGATTTTCTCGATGACGACGCCGAGGCTC
GCGCCTTGCGCAATGACTTGATCAGTGTCAGTGAAGTGGTCTTGACGCCGGGCGCCCATCACCTGATCGA
AGCCCGTGTTCCGGAACAGGCGAAAGCAATCGGTGTGGTGGGATTGTTTCGTTCTCCGGCGAGAGAGCGT
TGGCGCTTCGCGTTTGACGTTACCGAGAAACCCGTTATCAAGTCCGGGCTTACTCTGGGCTTCCACGCCT
GCGCGGTGACCAGCAACGGCACCGGCCTGATCCGGACGCCCACTGGTGACCCCGCCAGTCTGGTGGCCGT
GAGATGCCCCGCGTTGCCGCGCTGA