SecReT6
Protein ID: 407696022
SecReT6 ID706
T6SS typei4b
Gene symbol-
Locus tagB5T_02193
StrainAlcanivorax dieselolei B5
Repliconchromosome [GenBank: NC_018691] [Browse all T6SS(s) in this replicon]
Location [Strand]2404591..2405106 [+]
Producthypothetical protein
NoteTssB
UniProt IDK0CFH0
KEGG IDadi:B5T_02193
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 5.10E-60, Aligned region: 11..164
Protein Sequence: 171 a.a.     [Download]
>gi|407696022|ref|YP_006820810.1| hypothetical protein B5T_02193 [Alcanivorax dieselolei B5]
MSKKDSTQKRLQKVRPPRVQLTYDVEKGDAIEQKELPFVVGVLGDFSGNPEEPQPKVKDRKFVNVDMDNF
DEVMEGMAPRAVYRVPNKLTEEGGEFGVELKFKSMEDFRPEAVVEQVEPLRRLLESRTKLADLRNKLIGN
EKLEDLLSDVLKNTEQLKALREDSGADDDQE
 
Nucleotide Sequence: 516 bp     [Download]
>gi|407693844|ref|NC_018691.1|:2404591-2405106 Alcanivorax dieselolei B5 chromosome, complete genome
ATGTCCAAGAAGGATAGCACTCAAAAACGTCTTCAGAAGGTACGTCCGCCGCGAGTACAGCTCACCTATG
ACGTGGAGAAGGGCGATGCCATAGAACAGAAGGAACTGCCCTTTGTCGTCGGTGTTCTGGGCGATTTCAG
CGGCAATCCGGAAGAGCCGCAGCCGAAGGTCAAGGACCGCAAGTTCGTCAATGTGGACATGGATAACTTC
GACGAAGTGATGGAAGGCATGGCGCCACGGGCGGTCTACCGGGTACCGAACAAACTGACCGAAGAGGGCG
GTGAGTTCGGGGTCGAGCTGAAGTTCAAGTCCATGGAAGACTTCCGCCCCGAAGCGGTGGTTGAACAGGT
GGAACCGCTGCGCCGTTTGCTGGAGTCCCGCACCAAATTGGCGGACCTGCGCAACAAACTGATCGGCAAC
GAGAAGCTGGAAGACCTGCTTTCCGACGTGCTGAAAAACACCGAGCAACTGAAAGCGCTGCGAGAAGACA
GCGGCGCCGACGACGATCAGGAGTGA