SecReT6
Protein ID: 407696023
SecReT6 ID706
T6SS typei4b
Gene symbol-
Locus tagB5T_02194
StrainAlcanivorax dieselolei B5
Repliconchromosome [GenBank: NC_018691] [Browse all T6SS(s) in this replicon]
Location [Strand]2405112..2406602 [+]
Producthypothetical protein
NoteTssC
UniProt IDK0CD32
KEGG IDadi:B5T_02194
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 2.70E-193, Aligned region: 67..490
Protein Sequence: 496 a.a.     [Download]
>gi|407696023|ref|YP_006820811.1| hypothetical protein B5T_02194 [Alcanivorax dieselolei B5]
MGKEVASTNEAGTVTETEGLLDQIVEESRVAKSDEEHRRAKDIISELAKEVMEGTVVVSDNLNMTLDARI
AELDRLISEQLSAVMHAPEFQDLESTWRGLHYLCEHTSTGSMMKIKAFNAKKQDLIRDFNSAIDFDQSAL
FKKVYEEEFGTFGGAPFGTLIGDYAIGRQPQDMYFVEQMSHVAAAAHAPFITAASEDMLGLESFTDLGKP
RDLAKVFDSVEYAKWRSFRDGEDSRYVGLTLPRFLGRLPYNPKDGTTVEGFNFVEEVDGADHSKYLWCNT
AYAMATRLTAAFEDFGWCAAIRGVEGGGLVEDLPTHTFRTDDGEVALKCPTEVAITDRREKELSDLGFIP
LVHCKNTDYAAFFGAQSAQKPKKYNTDAANANAILSAQLQYMFAVSRIAHYLKAMMREKIGSFASAGNVE
EFLNRWISQYVLLDDNATQEAKAQYPLREASIQVSEVPGKPGSYRAVAFIRPHFQLDELSVSLRLVAELP
ASAKKS
 
Nucleotide Sequence: 1491 bp     [Download]
>gi|407693844|ref|NC_018691.1|:2405112-2406602 Alcanivorax dieselolei B5 chromosome, complete genome
ATGGGAAAAGAGGTGGCAAGCACTAATGAGGCGGGAACGGTAACCGAAACCGAAGGCCTTCTCGACCAGA
TCGTCGAAGAGAGCCGGGTGGCGAAATCCGATGAGGAGCATCGCCGGGCCAAGGATATCATCTCCGAGCT
GGCGAAAGAGGTCATGGAGGGCACCGTGGTGGTGTCCGATAACCTCAACATGACGCTGGACGCCCGTATC
GCCGAGCTGGATCGTCTGATCTCCGAGCAATTGAGCGCGGTAATGCACGCACCGGAATTTCAGGATCTCG
AGAGCACCTGGCGCGGGCTGCATTACCTTTGCGAGCATACCTCCACGGGCTCAATGATGAAGATCAAGGC
GTTCAACGCCAAGAAGCAGGATCTGATTCGTGACTTCAACTCCGCCATCGACTTTGATCAGAGCGCTCTG
TTCAAGAAAGTCTATGAAGAGGAATTTGGTACCTTTGGTGGCGCCCCGTTCGGAACCCTGATCGGTGACT
ACGCCATTGGCCGGCAACCTCAGGACATGTACTTCGTGGAGCAGATGTCCCATGTGGCCGCGGCGGCCCA
TGCGCCGTTCATTACCGCGGCTTCGGAAGACATGCTGGGACTGGAAAGTTTCACGGACCTGGGTAAGCCC
CGGGATCTCGCCAAGGTGTTCGATAGCGTGGAATACGCCAAATGGCGCTCCTTCCGCGACGGGGAAGACA
GCCGCTATGTGGGGCTGACGCTACCGCGCTTCCTCGGCCGTTTGCCCTACAACCCGAAAGATGGCACCAC
CGTCGAAGGATTCAACTTCGTGGAAGAAGTGGATGGCGCGGATCACAGCAAATACCTGTGGTGTAACACC
GCCTATGCCATGGCCACCCGGCTTACCGCGGCATTCGAGGACTTCGGCTGGTGTGCCGCCATTCGTGGCG
TCGAAGGTGGCGGGCTGGTGGAGGATTTGCCAACTCATACCTTCCGTACCGACGATGGTGAGGTGGCCCT
AAAATGTCCCACCGAAGTGGCGATCACGGACCGCCGCGAGAAGGAACTGAGCGACCTTGGTTTTATCCCT
CTGGTGCATTGCAAGAACACGGACTATGCCGCGTTCTTCGGTGCTCAGTCGGCGCAAAAGCCGAAGAAGT
ACAACACCGACGCGGCCAACGCCAACGCCATTCTCTCCGCGCAGCTGCAATACATGTTCGCGGTCTCCCG
CATCGCCCACTATCTCAAGGCGATGATGAGAGAGAAGATCGGCAGCTTCGCCTCGGCCGGCAACGTGGAA
GAATTTCTTAACCGCTGGATTTCCCAGTACGTGCTCCTTGACGATAACGCCACTCAGGAAGCCAAAGCTC
AGTACCCACTGCGTGAAGCCTCCATCCAGGTCTCGGAAGTGCCCGGCAAGCCGGGCTCCTACAGAGCAGT
CGCGTTCATCAGGCCGCATTTCCAGCTTGATGAACTGTCTGTATCGCTGCGGCTGGTGGCGGAGCTCCCG
GCTTCCGCCAAAAAGTCATAG