SecReT6
Protein ID: 407696024
SecReT6 ID706
T6SS typei4b
Gene symbol-
Locus tagB5T_02195
StrainAlcanivorax dieselolei B5
Repliconchromosome [GenBank: NC_018691] [Browse all T6SS(s) in this replicon]
Location [Strand]2406726..2407217 [+]
ProductHcp family protein
NoteTssD
UniProt IDK0CA77
KEGG IDadi:B5T_02195
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 9.40E-41, Aligned region: 5..138
Protein Sequence: 163 a.a.     [Download]
>gi|407696024|ref|YP_006820812.1| Hcp family protein [Alcanivorax dieselolei B5]
MQHAFLTIDSIKGESGDDKHPGWIEVHSFSQDILQPRAPTASSSGGQTAERVSFGPIEVVKSIDLSSTVL
SQACSNGTTFAKAEIDFMRADKDGNAINYYKIELKNVLVHRVTTTIGEDGMPQEVVLLSFAAIRWTYNQQ
KPEGGTGGKTVGQWNLNKNAPQF
 
Nucleotide Sequence: 492 bp     [Download]
>gi|407693844|ref|NC_018691.1|:2406726-2407217 Alcanivorax dieselolei B5 chromosome, complete genome
ATGCAACATGCATTTTTAACCATCGATTCCATTAAGGGCGAATCCGGTGACGATAAACATCCAGGATGGA
TCGAAGTCCACTCGTTCTCGCAGGACATCCTGCAGCCGCGAGCTCCCACCGCGTCCAGCTCGGGTGGTCA
GACCGCGGAACGGGTGAGCTTCGGCCCCATCGAAGTGGTCAAATCCATCGACCTGTCCAGTACCGTTCTG
AGCCAGGCCTGTTCCAACGGGACCACTTTCGCCAAGGCCGAGATTGATTTCATGCGGGCCGACAAAGACG
GCAACGCCATCAACTATTACAAGATCGAACTGAAAAACGTTCTTGTACACCGTGTGACCACCACCATCGG
TGAAGATGGCATGCCTCAGGAAGTGGTGCTTCTCAGCTTTGCCGCTATCCGTTGGACCTACAACCAACAG
AAGCCGGAAGGTGGCACGGGCGGCAAGACCGTCGGTCAGTGGAACCTCAACAAAAACGCACCTCAGTTCT
GA