SecReT6
Protein ID: 407696025
SecReT6 ID706
T6SS typei4b
Gene symbol-
Locus tagB5T_02196
StrainAlcanivorax dieselolei B5
Repliconchromosome [GenBank: NC_018691] [Browse all T6SS(s) in this replicon]
Location [Strand]2407334..2407843 [+]
Producttype VI secretion system lysozyme-like protein
NoteTssE
UniProt IDK0CDG8
KEGG IDadi:B5T_02196
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 3.90E-19, Aligned region: 39..144
Protein Sequence: 169 a.a.     [Download]
>gi|407696025|ref|YP_006820813.1| type VI secretion system lysozyme-like protein [Alcanivorax dieselolei B5]
MSVKRWDKGLEPSLLDKLFDDAPKQPGDQNIFKASSLGQYKETVARDLEGLLNSRMALSETLFDAFPQCR
KSLMVYGLRDFSAMSLVNAYDRALICRSLEDAISRHEPRLHDVTVTLDEGNAPGGGLHFTIHALLDIRPA
REPVSFDAMLQPSTLQYSVSGFRRNARVS
 
Nucleotide Sequence: 510 bp     [Download]
>gi|407693844|ref|NC_018691.1|:2407334-2407843 Alcanivorax dieselolei B5 chromosome, complete genome
ATGAGCGTGAAACGATGGGATAAGGGATTGGAACCCAGTCTGCTCGACAAGTTGTTTGATGACGCGCCGA
AGCAGCCGGGCGATCAGAATATCTTTAAAGCGTCTTCATTAGGGCAATACAAGGAAACCGTGGCGAGGGA
CCTGGAAGGTTTGCTCAATAGCCGTATGGCGTTGTCTGAAACCCTGTTCGATGCCTTTCCGCAATGCCGG
AAATCCCTGATGGTTTATGGGCTGAGAGACTTTTCCGCCATGAGTCTGGTCAACGCCTATGACCGGGCGC
TGATCTGTCGTTCCCTGGAGGATGCGATTTCCCGTCACGAGCCCCGATTACACGATGTCACCGTCACCCT
GGATGAAGGTAATGCACCGGGTGGCGGACTGCATTTTACCATTCACGCCTTGTTGGATATCCGTCCGGCG
CGGGAGCCTGTCAGTTTCGATGCGATGCTGCAGCCCTCGACGCTGCAGTACTCGGTGAGCGGATTCCGCC
GTAACGCCAGGGTATCCTGA