SecReT6
Protein ID: 407696026
SecReT6 ID706
T6SS typei4b
Gene symbol-
Locus tagB5T_02197
StrainAlcanivorax dieselolei B5
Repliconchromosome [GenBank: NC_018691] [Browse all T6SS(s) in this replicon]
Location [Strand]2407846..2409681 [+]
Producttype VI secretion protein
NoteTssF
UniProt IDK0CFR8
KEGG IDadi:B5T_02197
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 8.00E-207, Aligned region: 4..610
Protein Sequence: 611 a.a.     [Download]
>gi|407696026|ref|YP_006820814.1| type VI secretion protein [Alcanivorax dieselolei B5]
MRDLLPYYERELGFLRRYGKEFAERYPKIASRLLLSADVSEDPHVERLIESFALLSARISKKLDDDFPEF
TDALLDVLYPHYLRPFPSCSIARFDVGNALSTLSEPLRIPRGTALRSRPVRGVNCRFRTAYDVTLVPIVL
TEAVYRPVMRAPMAMGGVGAGQGQLSLRFELASTQLSFDTLGVDTIRLFTDGEPSFCAALRDALAYGIGA
TYVEADDSGRWFAVDQTPIRQVGFDDEESLIDYPSRSHPAYRLLTELFAFPEKFGFFDLDIKSLSSMASG
SFTVHFALDAPHTDGEQQQLLEGLGRDNVLLGCSPVVNLFRQRGEPIHVHERQASYPVVADARNAFAHEI
YSIDTVKRVRQTPLGEDIQTFRPFYSLHHGEDAGGEGLYWMARRDEELAEQSPGYETEITFVDLRFNPTV
PKTDVVGLDLTCTNRDLPSHLAYGVGGGDLTMETDTSVKSITMLRKPSRPRRFIGGRNAHWRLISHLSLN
HLSIAGSGLPALKEMLSLYDLSSAAVARRQIEGLIEVQHRPVTSWLPGRPFAAVARGVEINLTIDESSFV
GTGLSAFVAALDRFFGLYVHANSFTQLNILSRQSNEVLIQCPPRSGESTLV
 
Nucleotide Sequence: 1836 bp     [Download]
>gi|407693844|ref|NC_018691.1|:2407846-2409681 Alcanivorax dieselolei B5 chromosome, complete genome
ATGCGTGATCTGCTTCCGTATTACGAACGGGAACTCGGCTTTCTACGCCGGTATGGCAAGGAATTTGCCG
AGCGTTACCCCAAAATTGCCAGCCGTCTGCTGCTGTCGGCTGACGTCAGTGAAGATCCCCATGTGGAACG
GCTGATTGAGTCGTTCGCATTATTGAGCGCGCGTATTTCGAAAAAGCTCGATGATGATTTTCCGGAATTC
ACCGATGCGCTGCTTGACGTGCTGTACCCGCACTACTTGCGCCCGTTCCCGTCATGTTCGATTGCCCGCT
TCGATGTCGGAAACGCCCTGTCGACACTCAGCGAGCCACTACGCATTCCGCGGGGCACGGCGCTGCGTTC
GCGGCCGGTACGAGGGGTAAATTGCCGCTTCCGCACGGCCTATGATGTCACGCTGGTGCCGATTGTGTTG
ACCGAGGCCGTCTACCGCCCGGTAATGCGGGCTCCAATGGCGATGGGCGGCGTTGGCGCGGGGCAGGGCC
AGCTTTCTCTACGATTCGAGCTGGCCTCCACACAGTTGTCGTTCGACACGCTTGGCGTGGACACCATAAG
ACTGTTCACCGACGGCGAGCCTTCCTTCTGTGCCGCGCTTCGCGACGCGCTTGCCTATGGCATCGGCGCC
ACCTATGTGGAAGCGGACGACAGCGGACGATGGTTCGCGGTGGACCAGACACCGATACGGCAGGTCGGGT
TCGATGACGAGGAATCCTTGATCGATTATCCGAGTCGCTCCCATCCGGCTTATCGTCTGCTGACCGAACT
GTTTGCCTTTCCGGAAAAATTCGGTTTCTTCGATCTCGATATAAAATCGCTGTCGTCCATGGCATCCGGC
AGTTTTACCGTCCATTTCGCGCTGGATGCGCCGCACACCGACGGAGAGCAACAGCAGTTGCTTGAGGGGC
TCGGCAGGGACAATGTGCTGCTGGGATGTTCACCGGTGGTGAATCTGTTCCGCCAGCGGGGCGAGCCGAT
CCACGTGCATGAACGCCAGGCCAGCTATCCGGTGGTGGCCGACGCCCGCAATGCCTTTGCTCACGAGATT
TACTCCATCGACACGGTGAAACGGGTGCGGCAAACGCCGTTGGGAGAGGATATCCAGACCTTCCGCCCGT
TCTATTCCCTGCACCACGGTGAGGATGCCGGCGGTGAGGGGCTTTACTGGATGGCCAGACGGGATGAGGA
GCTGGCCGAACAGAGCCCTGGTTACGAAACCGAGATCACCTTCGTCGATCTGCGTTTCAATCCGACCGTA
CCCAAGACGGATGTGGTGGGTCTGGACCTGACCTGCACCAACCGGGATCTGCCCAGCCACCTGGCCTACG
GTGTCGGTGGCGGCGATCTGACCATGGAAACCGACACTTCGGTGAAAAGCATCACCATGCTGCGCAAACC
TTCGCGCCCGCGCCGATTCATCGGCGGCAGAAATGCACACTGGCGGTTGATCTCCCATTTGTCCCTCAAT
CATCTTTCGATTGCTGGCAGCGGCCTGCCAGCGTTGAAAGAGATGCTGTCACTTTACGATCTGTCCTCGG
CGGCGGTGGCACGACGGCAGATTGAAGGGCTGATCGAGGTGCAGCACCGTCCGGTCACCAGCTGGTTACC
GGGCCGGCCTTTCGCGGCGGTGGCAAGGGGAGTGGAAATCAATCTCACCATTGATGAAAGCAGCTTCGTC
GGCACCGGGCTGTCGGCTTTCGTGGCCGCCCTGGACCGCTTCTTTGGTCTTTATGTCCATGCCAACAGCT
TCACCCAGTTGAACATCCTTTCCCGTCAAAGCAATGAGGTACTGATTCAATGCCCTCCCCGAAGCGGCGA
ATCGACGCTGGTATAG