SecReT6
Protein ID: 407696027
SecReT6 ID706
T6SS typei4b
Gene symbol-
Locus tagB5T_02198
StrainAlcanivorax dieselolei B5
Repliconchromosome [GenBank: NC_018691] [Browse all T6SS(s) in this replicon]
Location [Strand]2409645..2410739 [+]
Productquinoprotein dehydrogenase
NoteTssG
UniProt IDK0CFH4
KEGG IDadi:B5T_02198
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 2.20E-92, Aligned region: 18..345
Protein Sequence: 364 a.a.     [Download]
>gi|407696027|ref|YP_006820815.1| quinoprotein dehydrogenase [Alcanivorax dieselolei B5]
MPSPKRRIDAGIAQQLLSEPHRFGFFQSVRIIEQLFRRQTRSADDDAVARHMRFGSSLSLGFPASELEKL
EAWSEEGERLDRPGAVDYTLTMEKLGKVQLTPSFMGLLGVKGALPWHYGEWLHEREIFQRDRAARAFLDI
FTNRAVALHYGAWKKYRLAIQYELDQRERFLPLLLSLAGVGVPGLRDRLNEAPGAIPDQAVAFHAATVGQ
RPVAAVQMQRLLADYFQVPIKVEQFIGAWYEIPEQQRTRLGASNARLGVGAVAGERVWQRDLRMRLVVGP
LAKDSFDAFLPGGEAAQALEKWLTMLTGASLEYEVRLVLKAEEINGCLLGDPERGGRLGWDGFLSTRQDA
GIRTDTTYGIHTLQ
 
Nucleotide Sequence: 1095 bp     [Download]
>gi|407693844|ref|NC_018691.1|:2409645-2410739 Alcanivorax dieselolei B5 chromosome, complete genome
ATGCCCTCCCCGAAGCGGCGAATCGACGCTGGTATAGCCCAGCAGTTGCTCAGTGAGCCTCACCGCTTTG
GGTTTTTCCAGTCGGTGCGGATCATCGAGCAGTTGTTCAGGCGCCAAACGCGCAGCGCGGATGACGACGC
GGTGGCCCGGCACATGCGCTTTGGCAGCAGCCTGTCTTTGGGTTTTCCCGCCAGTGAACTGGAGAAACTG
GAGGCCTGGTCGGAAGAAGGGGAGCGACTGGACCGGCCCGGGGCGGTGGATTACACCCTGACCATGGAAA
AACTGGGCAAAGTCCAGTTGACGCCGAGTTTCATGGGCCTGCTTGGCGTCAAGGGCGCCTTGCCCTGGCA
TTACGGCGAATGGCTGCATGAGCGGGAGATTTTTCAGCGAGACCGGGCCGCCCGCGCCTTTCTTGATATT
TTCACCAACCGGGCGGTGGCGCTGCATTACGGGGCCTGGAAGAAGTACCGGCTGGCGATCCAATATGAGT
TGGATCAACGAGAACGCTTCCTGCCCTTACTGTTGTCGCTGGCCGGCGTCGGCGTACCCGGGCTGCGAGA
CCGGTTGAATGAGGCTCCGGGCGCGATTCCGGATCAGGCGGTGGCCTTCCATGCCGCCACGGTGGGGCAG
CGGCCGGTGGCGGCGGTGCAGATGCAACGTTTGTTGGCCGATTACTTTCAGGTGCCAATCAAAGTAGAGC
AGTTCATCGGCGCCTGGTATGAGATTCCCGAGCAACAGCGCACCCGTCTGGGGGCGAGTAATGCCCGGCT
TGGTGTCGGCGCCGTGGCGGGCGAACGGGTTTGGCAACGGGACCTGAGGATGCGTTTGGTGGTGGGACCT
TTGGCGAAGGACAGCTTTGACGCCTTCCTGCCCGGTGGTGAAGCCGCCCAGGCGCTGGAAAAGTGGTTGA
CCATGCTGACCGGCGCCAGCCTTGAGTATGAAGTTCGCCTGGTGCTGAAAGCGGAAGAAATTAACGGATG
CCTGCTGGGTGATCCGGAGCGGGGCGGGCGTCTCGGCTGGGACGGGTTCCTGTCCACGCGCCAGGATGCC
GGCATCCGCACGGATACGACTTACGGTATCCATACACTTCAATGA