SecReT6
Protein ID: 407696028
SecReT6 ID706
T6SS typei4b
Gene symbol-
Locus tagB5T_02199
StrainAlcanivorax dieselolei B5
Repliconchromosome [GenBank: NC_018691] [Browse all T6SS(s) in this replicon]
Location [Strand]2410779..2413481 [+]
Producttype VI secretion ATPase, ClpV1 family
NoteTssH
UniProt IDK0CD35
KEGG IDadi:B5T_02199
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 1.60E-45, Aligned region: 226..303
AAA_2 [PF07724], Evalue: 1.60E-45, Aligned region: 437..460
AAA_2 [PF07724], Evalue: 1.60E-45, Aligned region: 505..529
AAA_2 [PF07724], Evalue: 1.60E-45, Aligned region: 607..775
AAA [PF00004], Evalue: 2.40E-19, Aligned region: 227..339
AAA [PF00004], Evalue: 2.40E-19, Aligned region: 612..696
AAA_5 [PF07728], Evalue: 4.40E-14, Aligned region: 227..247
AAA_5 [PF07728], Evalue: 4.40E-14, Aligned region: 286..357
AAA_5 [PF07728], Evalue: 4.40E-14, Aligned region: 611..731
AAA_16 [PF13191], Evalue: 2.70E-12, Aligned region: 21..77
AAA_16 [PF13191], Evalue: 2.70E-12, Aligned region: 204..250
AAA_16 [PF13191], Evalue: 2.70E-12, Aligned region: 271..306
AAA_16 [PF13191], Evalue: 2.70E-12, Aligned region: 484..491
AAA_16 [PF13191], Evalue: 2.70E-12, Aligned region: 589..653
AAA_16 [PF13191], Evalue: 2.70E-12, Aligned region: 677..699
ClpB_D2-small [PF10431], Evalue: 4.20E-12, Aligned region: 381..398
ClpB_D2-small [PF10431], Evalue: 4.20E-12, Aligned region: 782..856
Clp_N [PF02861], Evalue: 1.30E-09, Aligned region: 23..70
Clp_N [PF02861], Evalue: 1.30E-09, Aligned region: 111..129
Clp_N [PF02861], Evalue: 1.30E-09, Aligned region: 393..406
Clp_N [PF02861], Evalue: 1.30E-09, Aligned region: 422..439
AAA_22 [PF13401], Evalue: 6.40E-08, Aligned region: 226..319
AAA_22 [PF13401], Evalue: 6.40E-08, Aligned region: 361..393
AAA_22 [PF13401], Evalue: 6.40E-08, Aligned region: 608..632
AAA_22 [PF13401], Evalue: 6.40E-08, Aligned region: 673..705
Sigma54_activat [PF00158], Evalue: 2.40E-06, Aligned region: 221..287
Sigma54_activat [PF00158], Evalue: 2.40E-06, Aligned region: 609..730
AAA_17 [PF13207], Evalue: 4.80E-06, Aligned region: 74..105
AAA_17 [PF13207], Evalue: 4.80E-06, Aligned region: 227..297
AAA_17 [PF13207], Evalue: 4.80E-06, Aligned region: 440..494
AAA_17 [PF13207], Evalue: 4.80E-06, Aligned region: 611..647
Arch_ATPase [PF01637], Evalue: 2.60E-05, Aligned region: 207..367
Arch_ATPase [PF01637], Evalue: 2.60E-05, Aligned region: 608..651
Arch_ATPase [PF01637], Evalue: 2.60E-05, Aligned region: 682..705
AAA_29 [PF13555], Evalue: 5.90E-05, Aligned region: 217..243
AAA_29 [PF13555], Evalue: 5.90E-05, Aligned region: 607..636
IstB_IS21 [PF01695], Evalue: 8.10E-05, Aligned region: 211..248
IstB_IS21 [PF01695], Evalue: 8.10E-05, Aligned region: 611..629
AAA_25 [PF13481], Evalue: 0.00019, Aligned region: 222..250
AAA_25 [PF13481], Evalue: 0.00019, Aligned region: 283..323
AAA_25 [PF13481], Evalue: 0.00019, Aligned region: 469..498
AAA_25 [PF13481], Evalue: 0.00019, Aligned region: 606..630
AAA_25 [PF13481], Evalue: 0.00019, Aligned region: 790..857
AAA_19 [PF13245], Evalue: 0.00019, Aligned region: 227..251
AAA_19 [PF13245], Evalue: 0.00019, Aligned region: 607..633
NACHT [PF05729], Evalue: 0.00027, Aligned region: 227..255
NACHT [PF05729], Evalue: 0.00027, Aligned region: 612..632
ResIII [PF04851], Evalue: 0.00067, Aligned region: 214..247
ResIII [PF04851], Evalue: 0.00067, Aligned region: 292..309
ResIII [PF04851], Evalue: 0.00067, Aligned region: 582..632
AAA_30 [PF13604], Evalue: 0.0011, Aligned region: 15..40
AAA_30 [PF13604], Evalue: 0.0011, Aligned region: 221..324
AAA_30 [PF13604], Evalue: 0.0011, Aligned region: 606..640
AAA_18 [PF13238], Evalue: 0.0024, Aligned region: 227..247
AAA_18 [PF13238], Evalue: 0.0024, Aligned region: 613..636
RNA_helicase [PF00910], Evalue: 0.0064, Aligned region: 228..248
RNA_helicase [PF00910], Evalue: 0.0064, Aligned region: 612..633
Zeta_toxin [PF06414], Evalue: 0.007, Aligned region: 227..247
Zeta_toxin [PF06414], Evalue: 0.007, Aligned region: 603..651
SRP54 [PF00448], Evalue: 0.0082, Aligned region: 227..248
SRP54 [PF00448], Evalue: 0.0082, Aligned region: 610..642
T2SE [PF00437], Evalue: 0.0084, Aligned region: 213..249
T2SE [PF00437], Evalue: 0.0084, Aligned region: 599..648
MobB [PF03205], Evalue: 0.0091, Aligned region: 228..249
MobB [PF03205], Evalue: 0.0091, Aligned region: 610..652
MscS_porin [PF12795], Evalue: 0.0099, Aligned region: 435..501
Protein Sequence: 900 a.a.     [Download]
>gi|407696028|ref|YP_006820816.1| type VI secretion ATPase, ClpV1 family [Alcanivorax dieselolei B5]
MSINLKTLISKLNDRCRQAAERAASLCMAAGHYEVDLEHLFVALLEQPQSDLVLVARRSGIAPDALERDL
RVEMERLKTGNQRTPVFSPHLPTLFEHAWLLASLDSGTTRIRSGHLLLALLTEPDLSRLAQRSSALFTRF
DLEQLKHDFDKMTEGSEEGHRDAPLTEDAPSEEGEGKALGKTPALDQFTQNLTDRAREGAIDPVIGRDGE
IRQLVDILMRRRQNNPILTGEAGVGKTAVVEGLALRIAADDVPEPLKGVALHVLDMGLLQAGASVKGEFE
NRLKTVIDEVKKSAHPIILFIDEAHTLIGAGGQAGQNDAANLLKPALARGELRTIAATTWSEYKRYFEKD
AALARRFQVVKVDEPSEDLAAAMLRAMVPLMEQHFGVRILDEAVTEAVRLSHRYISGRQLPDKAVSVLDT
ACAKVALGQGATPAAIEDADKYLQRLDQEIAALSRDEQAGASHGERLADLESERAETQDRIVTLRERLDR
EVALVQSIQQRRDGREEAAAAGQAGPDHSIPELLSRLREVQGETPMVPLQADGSVVAEIVSNWTGIPLGR
MVKDEIATISNLSALLAERVTGQQHALDAIAQRVRTATARLEDPNKPRGVFLFVGPSGVGKTETALALAD
ILYGGERKLITINMSEYQEAHTVSGLKGSPPGYVGYGEGGVLTEAVRRNPYSVVLLDEVEKAHPDVLEMF
FQVFDKGVMDDAEGREIDFRNTLIILTSNVGSSQIMQSCLNQEAQQLPDPEALHELLRPALYKAFKPAFL
GRLKVVPYYPISDDVLVRIIEMKLDRIARRVAENHGALFEWDDALAESVLARCTEVDSGARNVDHILNGT
LLPEIAESVLAAMAEGAKIASIRVTADDNGDFQYTVTPEGVPSTGAESPQILSFHHRSES
 
Nucleotide Sequence: 2703 bp     [Download]
>gi|407693844|ref|NC_018691.1|:2410779-2413481 Alcanivorax dieselolei B5 chromosome, complete genome
ATGAGCATTAACCTGAAAACACTGATCAGCAAACTCAACGACCGCTGCCGGCAGGCGGCGGAGAGGGCCG
CCAGCCTGTGCATGGCCGCGGGACATTACGAAGTCGATCTGGAGCATTTGTTCGTGGCGTTGCTGGAGCA
GCCACAAAGCGATCTGGTTCTGGTAGCACGCCGTAGCGGCATAGCGCCGGATGCACTGGAACGAGACCTT
CGCGTTGAGATGGAAAGACTGAAAACCGGTAATCAGCGTACCCCGGTGTTCTCTCCGCATCTGCCGACAC
TGTTCGAACATGCCTGGCTGCTGGCCTCGCTGGATTCCGGCACCACCCGTATCCGCAGCGGGCATCTGTT
GCTGGCGTTGTTGACGGAACCGGACCTCTCTCGCCTGGCGCAACGCAGTTCCGCGCTATTTACCCGGTTT
GATCTGGAGCAACTCAAGCACGACTTCGACAAAATGACGGAAGGGTCGGAGGAAGGGCATCGTGATGCAC
CTCTGACGGAAGACGCGCCCAGCGAGGAAGGCGAGGGCAAAGCGCTCGGCAAGACGCCGGCTCTGGATCA
GTTCACCCAGAATCTCACTGACCGGGCCCGGGAAGGCGCCATTGACCCAGTCATCGGCCGTGATGGTGAG
ATCCGTCAGTTGGTGGACATCCTCATGCGCCGGCGTCAGAACAACCCGATCCTCACCGGTGAAGCCGGGG
TGGGCAAAACGGCGGTGGTGGAAGGGCTGGCGTTGCGGATCGCGGCCGACGATGTGCCGGAACCGCTCAA
GGGCGTGGCGTTGCACGTCCTTGATATGGGCTTGTTGCAAGCCGGTGCCAGTGTCAAAGGTGAGTTCGAG
AACCGGCTCAAGACGGTGATTGACGAGGTCAAGAAAAGCGCCCATCCGATCATCCTTTTCATCGACGAAG
CCCATACCCTGATCGGTGCCGGCGGCCAGGCCGGCCAGAACGATGCCGCCAATCTGTTGAAGCCGGCACT
GGCCCGCGGCGAGCTGCGCACCATCGCCGCCACCACCTGGAGTGAGTATAAGCGCTACTTCGAAAAAGAC
GCGGCGCTGGCCCGGCGCTTCCAGGTAGTGAAGGTGGATGAACCCAGTGAAGACCTGGCCGCTGCCATGC
TGCGTGCCATGGTTCCATTGATGGAGCAGCATTTTGGTGTGCGCATCCTCGACGAAGCCGTTACCGAGGC
GGTGAGATTGTCGCACCGTTACATCAGCGGCCGGCAACTGCCGGACAAGGCGGTATCGGTATTGGATACC
GCCTGCGCCAAAGTCGCGCTGGGGCAGGGCGCCACGCCCGCCGCTATCGAGGACGCCGACAAATATCTTC
AACGCCTGGACCAGGAAATCGCCGCGCTGTCCCGGGACGAGCAGGCCGGGGCCTCCCACGGAGAACGCCT
GGCGGATTTGGAAAGCGAGCGGGCGGAGACCCAGGACCGCATCGTTACTCTGCGGGAACGTCTCGACCGG
GAAGTGGCATTGGTACAGAGCATCCAGCAGCGACGGGATGGCCGGGAGGAGGCGGCGGCCGCTGGCCAGG
CCGGTCCCGATCACAGTATCCCCGAGCTGTTATCCCGGTTGCGGGAGGTGCAAGGCGAGACGCCCATGGT
GCCTTTGCAAGCCGACGGCTCGGTGGTGGCGGAGATCGTCTCCAATTGGACCGGGATTCCCCTGGGCCGC
ATGGTCAAGGATGAGATCGCGACCATTTCCAATCTGTCCGCTCTGTTGGCGGAGCGGGTTACCGGACAAC
AGCATGCACTGGATGCCATTGCGCAACGGGTGCGCACCGCCACCGCCAGGCTGGAAGATCCCAACAAGCC
CAGAGGCGTGTTTCTGTTCGTCGGGCCCTCCGGCGTGGGTAAAACCGAAACCGCGCTGGCACTGGCCGAC
ATTCTCTACGGTGGCGAGCGCAAGCTGATCACCATCAATATGAGCGAGTATCAGGAAGCGCATACGGTTT
CCGGCCTGAAAGGCTCGCCACCCGGGTATGTGGGTTACGGCGAGGGTGGGGTGCTGACCGAAGCGGTACG
CCGCAATCCCTATAGCGTGGTGTTGCTGGACGAAGTGGAGAAGGCGCATCCGGACGTACTGGAAATGTTT
TTCCAGGTCTTCGACAAGGGCGTGATGGACGATGCCGAAGGGCGCGAAATCGATTTCCGCAACACTCTGA
TCATTCTTACGTCCAACGTCGGCTCCTCGCAGATCATGCAATCCTGTCTGAACCAGGAAGCACAACAACT
GCCCGACCCGGAGGCACTCCATGAACTGTTGCGGCCGGCGCTTTACAAGGCCTTCAAACCCGCCTTCCTG
GGACGGCTCAAAGTGGTGCCGTACTACCCGATCAGCGATGACGTCCTGGTCCGCATCATCGAGATGAAAC
TGGACCGCATCGCGCGCCGGGTGGCGGAGAATCATGGCGCCCTGTTCGAATGGGACGACGCCTTGGCGGA
ATCGGTGCTGGCCCGTTGCACCGAGGTGGACAGCGGCGCTCGCAATGTGGACCACATTCTCAACGGCACG
CTTTTGCCGGAAATTGCCGAGTCCGTCCTCGCCGCCATGGCCGAGGGCGCTAAAATAGCCAGTATCCGGG
TGACCGCGGATGACAACGGTGATTTTCAATACACGGTAACGCCGGAAGGCGTGCCGTCAACCGGAGCCGA
GTCTCCACAAATCTTGTCCTTTCATCACAGGAGTGAATCATGA