SecReT6
Protein ID: 407696030
SecReT6 ID706
T6SS typei4b
Gene symbol-
Locus tagB5T_02201
StrainAlcanivorax dieselolei B5
Repliconchromosome [GenBank: NC_018691] [Browse all T6SS(s) in this replicon]
Location [Strand]2413896..2416862 [+]
ProductRhs element Vgr protein
NoteTssI
UniProt IDK0CDH2
KEGG IDadi:B5T_02201
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 1.00E-54, Aligned region: 53..354
Phage_GPD [PF05954], Evalue: 1.00E-54, Aligned region: 583..611
Phage_GPD [PF05954], Evalue: 1.00E-54, Aligned region: 922..967
DUF2345 [PF10106], Evalue: 1.10E-39, Aligned region: 31..60
DUF2345 [PF10106], Evalue: 1.10E-39, Aligned region: 586..652
DUF2345 [PF10106], Evalue: 1.10E-39, Aligned region: 715..881
T6SS_Vgr [PF13296], Evalue: 1.30E-18, Aligned region: 578..679
Phage_base_V [PF04717], Evalue: 9.70E-12, Aligned region: 432..533
Protein Sequence: 988 a.a.     [Download]
>gi|407696030|ref|YP_006820818.1| Rhs element Vgr protein [Alcanivorax dieselolei B5]
MDVIASLMSALSAPGQGARLLQLQTPLGPDVLVPESCHGIEAVSGAGVSAGAGFRFDITALSVDARLQAD
DLLGQPVLLTLLTADSRTDRRPFHGHVTHFEYLESNGGLARYALVIEPWTVFLQQWVDSHVYQDMTAMEA
LDTLFGRLAARGGVVAPRWRWELADNALYLRHSLAAQLEEDGLDFMTRILSEQGLFFWFEHQVDSHTLVI
ADYNSAFSDLGGIRYHRSDVTEQEDAIQQWRPGRRAHAAAIRRASWDYRSLKTLSSQQNSADMAWSRAED
DDSPTAYAWHNQAETEWRSRRHIEVLEAAGKRVEGNGTWRRLRPGGQFQLHQHPGYAEDATFLCLAVTHD
ARNNLSSDLMAQADQRFETPRPDFPDAPERLGGSALPSPGSAPESDFYRNDFVALQVDTPFRPLDTRSRH
GQSRIRGRGLHSAVVTADSTPVHTDRDHRIKMQYPWQRGEGASSGESHPENGIDNAPASGGAWTWVRTLT
PWAGEDWGGVAVPRTGQESLTLFLEGQPERPVAIGTVYNGQGNDEAQHNQVGGGLAGATGNAAPWFSGND
HKAVYTGLKSQALSASQQGNSGHQWLLMDSTEGQARTEAGSTQHQSRLSLGHLKGGNDNLRQGERGFGAD
LNTTSTGALRAGQGVLLSTEAGQWQMSTDGAQARLQGNAELLKTLNDAARNQNAGQAGEADELPSQRSLS
SVLTTLKDTRSGSGGEQGGDGSPPGWSRPLIVATSPDGLASVTQQAQTWMAGTTTTLVSGADINWMSKNR
TVMTVSGGLSLYNNGASPASGKPNQESGIQLHAAQGKVSARAPKQPLTLAAAQDVSLASTNSQATLAAPN
QPLLLASGGAYLKLDGGNIELGAPGGVHLQAAMKQFVGPGSGSAQAQMLTGGDLDVCDVNLDEADKAGSW
TVALGAMGAGEEQNVGAYDEAFQLTDQQTGEPLVKVHYRIVRADGTAEEGTTNEQGMTHVVNTDVPEQLT
IEIEDLEA
 
Nucleotide Sequence: 2967 bp     [Download]
>gi|407693844|ref|NC_018691.1|:2413896-2416862 Alcanivorax dieselolei B5 chromosome, complete genome
ATGGATGTGATTGCCAGTCTGATGAGTGCGTTGTCCGCGCCGGGGCAGGGCGCTCGTTTATTGCAGCTCC
AAACCCCGTTGGGGCCGGATGTTCTGGTGCCGGAAAGCTGCCACGGCATTGAGGCGGTTTCCGGCGCTGG
TGTCTCCGCCGGCGCCGGCTTTCGCTTTGACATCACGGCACTGTCGGTGGACGCCCGTCTGCAGGCGGAC
GACCTGCTCGGGCAGCCGGTTCTGCTGACATTGCTCACCGCGGACTCACGGACGGATCGCCGCCCCTTCC
ATGGTCATGTAACCCATTTCGAGTATCTGGAGAGCAACGGTGGCCTGGCCCGTTATGCGCTGGTGATCGA
GCCGTGGACCGTGTTTCTGCAGCAGTGGGTGGACAGTCATGTCTATCAGGACATGACGGCCATGGAAGCC
CTCGACACCCTGTTCGGGCGATTGGCGGCCCGTGGTGGCGTGGTTGCGCCCCGCTGGCGCTGGGAATTGG
CGGACAACGCGCTTTACCTCCGGCACAGTCTCGCCGCGCAACTGGAGGAAGACGGTCTGGACTTCATGAC
CCGAATCCTGTCGGAGCAGGGGCTGTTTTTCTGGTTCGAGCACCAGGTCGACAGCCATACGCTGGTGATC
GCTGATTATAACAGCGCGTTCTCGGACCTTGGCGGGATCCGCTATCATCGCAGCGATGTCACCGAGCAGG
AAGACGCCATCCAGCAATGGCGGCCGGGACGCCGCGCCCACGCCGCCGCCATCCGCCGGGCCAGCTGGGA
TTACCGGTCGCTGAAAACATTGTCCTCGCAACAAAACAGCGCGGATATGGCGTGGTCACGGGCGGAGGAT
GACGACAGCCCCACGGCCTATGCCTGGCACAATCAGGCGGAAACCGAATGGCGTAGCCGCCGCCACATTG
AAGTCCTGGAAGCCGCCGGAAAACGGGTGGAAGGGAATGGAACCTGGCGGCGTCTGCGTCCCGGCGGGCA
ATTCCAGCTTCATCAGCACCCCGGATACGCAGAGGATGCCACCTTCCTCTGTCTGGCGGTAACACACGAT
GCTCGCAACAATTTAAGCTCGGATCTGATGGCGCAAGCCGATCAGCGATTCGAGACGCCACGGCCTGACT
TTCCTGATGCGCCTGAGCGTCTCGGTGGCAGTGCCTTGCCATCTCCGGGCAGCGCACCGGAGTCTGATTT
TTACCGTAATGATTTCGTCGCTCTGCAGGTGGATACGCCTTTTCGCCCCTTGGATACCAGGTCACGTCAC
GGCCAGTCCCGGATCCGTGGCCGGGGCCTGCACAGCGCGGTGGTGACCGCGGACAGTACGCCGGTGCACA
CCGACCGTGATCATCGCATCAAGATGCAATACCCCTGGCAACGAGGCGAAGGCGCCAGTAGTGGGGAATC
CCACCCTGAAAACGGCATCGACAACGCTCCGGCCAGCGGTGGCGCCTGGACCTGGGTACGCACACTGACT
CCATGGGCCGGCGAGGATTGGGGCGGTGTCGCCGTGCCCCGAACCGGACAGGAAAGTCTCACCCTGTTTC
TGGAAGGCCAGCCGGAAAGACCCGTCGCCATCGGTACTGTTTACAACGGCCAGGGCAATGACGAGGCTCA
ACATAATCAGGTTGGAGGCGGTCTCGCCGGTGCCACGGGTAACGCCGCCCCCTGGTTCAGCGGAAACGAT
CACAAAGCGGTCTACACCGGTCTGAAGAGCCAGGCACTCTCCGCCAGTCAGCAAGGTAACAGCGGCCACC
AATGGCTACTGATGGACAGCACCGAAGGTCAGGCCCGTACCGAAGCCGGCAGCACCCAACATCAGAGCCG
TTTGAGCCTGGGCCACCTGAAAGGCGGGAATGACAACCTGCGGCAAGGAGAAAGAGGCTTTGGCGCCGAC
CTGAACACCACATCCACCGGAGCCCTTCGGGCCGGACAAGGTGTCCTGCTCAGCACGGAGGCGGGGCAAT
GGCAAATGAGCACCGATGGCGCGCAGGCGCGGCTGCAGGGCAATGCGGAGCTGTTGAAGACGCTCAACGA
CGCCGCGCGCAACCAGAACGCCGGGCAGGCAGGCGAAGCCGACGAATTGCCTTCCCAGAGATCATTAAGC
AGCGTATTAACCACGCTCAAAGACACCCGGTCCGGCTCCGGAGGAGAGCAGGGCGGTGACGGCTCACCGC
CCGGCTGGTCCCGTCCGCTGATCGTCGCCACCAGCCCGGATGGGCTGGCCAGCGTCACTCAGCAGGCACA
AACTTGGATGGCGGGTACCACCACCACGCTGGTCAGCGGCGCGGACATCAACTGGATGAGCAAGAACCGC
ACCGTCATGACCGTGAGCGGCGGACTGAGCCTCTACAACAACGGCGCCTCGCCGGCCAGCGGCAAACCCA
ACCAGGAAAGCGGGATTCAACTGCACGCCGCCCAAGGTAAAGTCAGCGCCCGCGCCCCAAAACAACCCTT
GACGCTCGCCGCAGCACAGGATGTCTCCCTGGCCAGCACCAACAGCCAGGCCACCCTGGCCGCCCCCAAC
CAACCGCTCCTGCTCGCCTCTGGCGGCGCCTACCTCAAACTCGATGGCGGCAACATCGAGCTAGGTGCTC
CGGGCGGCGTGCATTTGCAGGCGGCGATGAAACAGTTTGTCGGGCCCGGTTCGGGGAGCGCGCAGGCGCA
GATGTTGACGGGGGGTGATCTCGATGTTTGTGATGTCAATCTTGACGAGGCGGATAAGGCGGGAAGCTGG
ACTGTTGCTCTAGGGGCAATGGGGGCAGGGGAAGAGCAAAATGTGGGCGCCTATGATGAGGCGTTTCAGT
TAACTGACCAGCAAACAGGCGAACCTCTGGTGAAGGTGCATTACCGTATCGTCAGGGCAGATGGCACGGC
TGAAGAGGGGACGACCAATGAACAGGGAATGACCCATGTCGTAAATACAGACGTGCCGGAACAACTGACC
ATCGAAATTGAAGATCTCGAGGCTTGA