SecReT6
Protein ID: 407712927
SecReT6 ID707
T6SS typei2
Gene symbol-
Locus tagBUPH_01734
StrainBurkholderia phenoliruptrix BR3459a
Repliconchromosome I [GenBank: NC_018695] [Browse all T6SS(s) in this replicon]
Location [Strand]1352649..1353080 [-]
Producttype VI secretion system protein
NoteTssE
UniProt IDK0DKJ4
KEGG IDbpx:BUPH_01734
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 2.30E-18, Aligned region: 32..115
Protein Sequence: 143 a.a.     [Download]
>gi|407712927|ref|YP_006833492.1| type VI secretion system protein [Burkholderia phenoliruptrix BR3459a]
MAAGPSLYDMLLGQIGGEPLDAHDDRTLECLSVQQNVRRILNTRAGALKHLPDYGLPDLTNIYKALPASA
HLLKEQMEATLLKYEPRIRKIDVDILKNDDPGVLVSFEMTCHLWKAGLVRFGTYFEPPGRMRVEHRQQAR
PVS
 
Nucleotide Sequence: 432 bp     [Download]
>gi|407711772|ref|NC_018695.1|:c1353080-1352649 Burkholderia phenoliruptrix BR3459a chromosome 1, complete sequence
ATGGCGGCCGGCCCTTCTCTCTACGACATGCTGCTCGGCCAGATCGGGGGCGAGCCGCTCGACGCCCACG
ACGACCGGACGCTCGAATGCCTGAGCGTGCAACAGAACGTGCGGCGCATTCTCAACACGCGCGCGGGTGC
GCTCAAGCATCTGCCCGACTATGGCTTGCCGGATTTGACCAACATCTACAAGGCATTGCCCGCTTCCGCG
CACCTGCTTAAGGAGCAAATGGAGGCGACGCTGCTCAAATACGAACCCCGCATTCGCAAAATCGATGTCG
ATATCCTCAAGAACGACGATCCCGGCGTGCTCGTAAGTTTCGAGATGACATGTCACCTCTGGAAAGCGGG
ACTCGTCAGGTTCGGGACATACTTCGAACCACCCGGCCGCATGCGGGTCGAGCACCGGCAACAGGCACGA
CCCGTCAGTTGA