SecReT6
Protein ID: 407712928
SecReT6 ID707
T6SS typei2
Gene symbol-
Locus tagBUPH_01735
StrainBurkholderia phenoliruptrix BR3459a
Repliconchromosome I [GenBank: NC_018695] [Browse all T6SS(s) in this replicon]
Location [Strand]1353093..1355831 [-]
Producttype VI secretion system protein VasG
NoteTssH
UniProt IDK0DH45
KEGG IDbpx:BUPH_01735
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 3.40E-41, Aligned region: 252..289
AAA_2 [PF07724], Evalue: 3.40E-41, Aligned region: 629..793
AAA [PF00004], Evalue: 7.00E-18, Aligned region: 254..366
AAA [PF00004], Evalue: 7.00E-18, Aligned region: 634..761
AAA_5 [PF07728], Evalue: 3.40E-15, Aligned region: 254..276
AAA_5 [PF07728], Evalue: 3.40E-15, Aligned region: 315..384
AAA_5 [PF07728], Evalue: 3.40E-15, Aligned region: 633..754
ClpB_D2-small [PF10431], Evalue: 1.40E-12, Aligned region: 800..873
AAA_16 [PF13191], Evalue: 1.90E-11, Aligned region: 231..276
AAA_16 [PF13191], Evalue: 1.90E-11, Aligned region: 298..339
AAA_16 [PF13191], Evalue: 1.90E-11, Aligned region: 497..546
AAA_16 [PF13191], Evalue: 1.90E-11, Aligned region: 614..669
AAA_16 [PF13191], Evalue: 1.90E-11, Aligned region: 649..728
AAA_16 [PF13191], Evalue: 1.90E-11, Aligned region: 779..832
Clp_N [PF02861], Evalue: 6.90E-07, Aligned region: 36..87
AAA_22 [PF13401], Evalue: 7.60E-07, Aligned region: 253..339
AAA_22 [PF13401], Evalue: 7.60E-07, Aligned region: 537..554
AAA_22 [PF13401], Evalue: 7.60E-07, Aligned region: 632..653
AAA_22 [PF13401], Evalue: 7.60E-07, Aligned region: 694..727
AAA_19 [PF13245], Evalue: 6.80E-06, Aligned region: 251..276
AAA_19 [PF13245], Evalue: 6.80E-06, Aligned region: 631..655
IstB_IS21 [PF01695], Evalue: 9.70E-06, Aligned region: 238..274
IstB_IS21 [PF01695], Evalue: 9.70E-06, Aligned region: 633..651
IstB_IS21 [PF01695], Evalue: 9.70E-06, Aligned region: 746..774
AAA_25 [PF13481], Evalue: 1.10E-05, Aligned region: 254..291
AAA_25 [PF13481], Evalue: 1.10E-05, Aligned region: 309..350
AAA_25 [PF13481], Evalue: 1.10E-05, Aligned region: 526..617
AAA_25 [PF13481], Evalue: 1.10E-05, Aligned region: 627..657
AAA_17 [PF13207], Evalue: 1.40E-05, Aligned region: 254..388
AAA_17 [PF13207], Evalue: 1.40E-05, Aligned region: 633..670
TIP49 [PF06068], Evalue: 6.30E-05, Aligned region: 254..276
TIP49 [PF06068], Evalue: 6.30E-05, Aligned region: 302..334
TIP49 [PF06068], Evalue: 6.30E-05, Aligned region: 632..668
NACHT [PF05729], Evalue: 8.50E-05, Aligned region: 254..281
NACHT [PF05729], Evalue: 8.50E-05, Aligned region: 633..656
Arch_ATPase [PF01637], Evalue: 0.00015, Aligned region: 232..270
Arch_ATPase [PF01637], Evalue: 0.00015, Aligned region: 306..403
Arch_ATPase [PF01637], Evalue: 0.00015, Aligned region: 632..645
AAA_18 [PF13238], Evalue: 0.0003, Aligned region: 254..276
AAA_18 [PF13238], Evalue: 0.0003, Aligned region: 634..663
Zeta_toxin [PF06414], Evalue: 0.00054, Aligned region: 248..279
Zeta_toxin [PF06414], Evalue: 0.00054, Aligned region: 632..673
Sigma54_activat [PF00158], Evalue: 0.00066, Aligned region: 236..268
Sigma54_activat [PF00158], Evalue: 0.00066, Aligned region: 633..751
Sigma54_activat [PF00158], Evalue: 0.00066, Aligned region: 782..804
AAA_29 [PF13555], Evalue: 0.00082, Aligned region: 247..270
AAA_29 [PF13555], Evalue: 0.00082, Aligned region: 630..658
Mg_chelatase [PF01078], Evalue: 0.0029, Aligned region: 250..288
Mg_chelatase [PF01078], Evalue: 0.0029, Aligned region: 633..676
DUF258 [PF03193], Evalue: 0.0041, Aligned region: 238..272
DUF258 [PF03193], Evalue: 0.0041, Aligned region: 632..645
AAA_24 [PF13479], Evalue: 0.005, Aligned region: 70..125
AAA_24 [PF13479], Evalue: 0.005, Aligned region: 254..269
AAA_24 [PF13479], Evalue: 0.005, Aligned region: 634..718
Protein Sequence: 912 a.a.     [Download]
>gi|407712928|ref|YP_006833493.1| type VI secretion system protein VasG [Burkholderia phenoliruptrix BR3459a]
MAITRFNSDRSLMILRDTTHLLRRLNPHCAKALEAAASLCLARLSHEITVEHWLLKLIEAGDGDIPAILR
HYGIDVDALWDALIAAIEHVPRDLRGKPALSVQMATVLQDAWLRAAAGNDDASIRSGNLMQAIVDAPHVL
RAQNIWPLLSISSAQIERLLLRLAHRSCESAQDDPDAQMTEPARAAPDDAHAPGTAAPDARTVQQNGGAH
ALARFALDLTDKARNGQIDPVFGRDREIQQMVDVLARRRKNNPILVGDPGVGKTALVEGLALRIAEGSVP
EVIRDARILTLDLGLLQAGAGVKGEFEQRLKNVIDEVQASLVPILLFIDEAHTLIGAGNAAGSADAANLL
KPALARGTLRTIAATTWSEYKEFFERDAALERRFQIIKVEEPDDDAACLMLRGLRNRYAEYHHVHIRDEA
LVAAVKLSRRYIPARQLPDKAVDLIDTAAARVRMGLESPPAELQRARASVAALELEDATLADDARAGMDH
AQAHRATLGATLVKAKAELTDLQSRYASELKLVQALHEWREREPARRDHASLAQARHALANAQGKAPLIF
ADVDAQAIARVVAEWTGVPVGHLVEDELQCLLALEAQLATRVVSQVDALGALAESLRTAKAGLKNEHAPL
GVFLLAGPSGVGKTETALALADLLFGGEAALTTINMSEYQEPHTVSQLKGSPPGYVGYGRGGILTEAVRQ
RPYSVVLLDEIEKAHRDVLDIFYQVFDRGVMRDGEGREIDFRNCVILMTSNLGSAQIDEATADNPEIAQA
ALLEIIRPALVAHFQPALLARFQTLIYRPLGATALESIVRMKLGKVADRLRRQHGIELTCDELLIETMAE
LCLARESGARNVDAFLNQRILPTVSGELLARMASGAVPATITLSSSAERGLTIDFVDRDEAAHAEAHAPL
VA
 
Nucleotide Sequence: 2739 bp     [Download]
>gi|407711772|ref|NC_018695.1|:c1355831-1353093 Burkholderia phenoliruptrix BR3459a chromosome 1, complete sequence
ATGGCCATCACCCGCTTCAATTCCGACCGCTCCCTCATGATCTTGCGCGATACCACTCACCTGCTCCGCC
GACTCAACCCGCATTGCGCGAAGGCGCTCGAGGCGGCTGCGAGTCTTTGCCTCGCGCGGCTTTCGCACGA
GATAACAGTCGAGCACTGGCTGCTGAAGCTGATCGAGGCAGGCGACGGCGACATTCCGGCAATCCTCCGA
CACTATGGGATCGATGTCGATGCGCTGTGGGACGCGTTGATCGCAGCCATCGAGCACGTACCCCGCGACC
TCCGGGGCAAGCCGGCGCTGTCCGTTCAAATGGCGACCGTATTACAAGACGCCTGGCTTAGAGCCGCGGC
GGGTAACGATGACGCATCGATTCGGTCGGGCAACCTGATGCAAGCCATCGTCGACGCTCCGCACGTGCTG
CGTGCGCAGAATATCTGGCCGCTGCTGTCAATCAGCAGTGCCCAGATCGAACGGCTCCTGCTGCGTCTCG
CCCATCGTTCGTGTGAGAGCGCACAAGACGATCCGGATGCGCAGATGACCGAACCGGCTCGCGCCGCGCC
GGACGATGCGCACGCACCCGGGACAGCGGCCCCGGACGCTCGAACAGTCCAGCAAAATGGCGGCGCACAT
GCCCTCGCCCGCTTTGCGCTCGACCTGACCGACAAGGCGCGCAACGGCCAGATTGATCCCGTATTCGGCC
GCGACCGTGAGATCCAGCAGATGGTCGACGTGCTCGCACGTCGGCGCAAGAACAATCCGATCCTGGTCGG
TGATCCGGGTGTAGGCAAAACCGCGCTCGTTGAGGGGCTTGCGCTGCGCATAGCCGAGGGCAGCGTGCCT
GAAGTGATCCGCGACGCGCGCATCCTCACACTCGACCTTGGGCTGCTGCAGGCTGGCGCTGGTGTCAAAG
GCGAGTTCGAACAGCGGCTGAAGAACGTGATCGACGAGGTGCAAGCCTCGCTCGTGCCGATCCTGCTGTT
CATCGACGAAGCCCACACGCTGATCGGCGCCGGTAACGCAGCAGGGAGCGCCGACGCCGCCAATCTGCTC
AAGCCTGCGCTCGCGCGCGGCACGTTGCGCACAATCGCCGCCACCACCTGGTCGGAATATAAGGAATTCT
TCGAGCGCGACGCCGCGCTCGAGCGACGTTTCCAGATCATCAAGGTTGAAGAGCCTGACGACGACGCTGC
GTGCCTGATGCTACGTGGCCTCAGGAATCGCTACGCGGAGTATCACCATGTTCACATTCGCGACGAGGCG
CTGGTCGCCGCGGTGAAACTTTCGCGCCGCTACATTCCCGCACGTCAACTGCCGGACAAGGCAGTCGACC
TGATCGATACAGCAGCCGCGCGCGTCCGCATGGGCCTCGAATCCCCGCCGGCGGAACTGCAGCGGGCACG
CGCCTCGGTGGCGGCTCTGGAACTCGAGGACGCGACTTTGGCCGACGACGCGCGTGCAGGCATGGACCAC
GCGCAAGCGCACCGGGCGACACTGGGCGCAACGCTTGTAAAGGCGAAGGCAGAATTGACGGATTTGCAGT
CTCGTTATGCGAGCGAGTTGAAGCTCGTGCAGGCGCTGCACGAATGGCGTGAACGAGAACCGGCTCGACG
CGACCACGCTTCACTGGCTCAGGCGAGGCATGCACTTGCTAACGCTCAAGGCAAGGCACCGTTGATCTTT
GCCGACGTCGACGCACAGGCGATCGCGCGCGTCGTCGCGGAGTGGACGGGCGTGCCGGTCGGCCATCTCG
TCGAGGACGAACTCCAGTGCCTGCTCGCACTCGAAGCGCAGCTTGCTACGCGCGTCGTGTCTCAGGTCGA
CGCACTTGGCGCGCTTGCCGAGAGTCTGCGCACCGCAAAAGCGGGACTCAAGAACGAGCATGCTCCGCTC
GGCGTATTTCTGCTAGCTGGCCCGTCAGGCGTAGGCAAGACCGAGACCGCCCTCGCCCTGGCCGATCTGC
TGTTTGGCGGCGAAGCGGCGCTCACGACAATCAACATGTCGGAGTACCAGGAACCGCACACGGTGTCGCA
GTTGAAGGGCTCGCCCCCGGGTTACGTCGGATATGGCCGTGGCGGCATTCTGACGGAGGCAGTGCGCCAG
CGTCCCTATAGCGTCGTGCTGCTCGACGAAATCGAGAAGGCTCATCGCGACGTGCTTGACATCTTTTATC
AGGTATTCGATCGCGGCGTCATGCGTGACGGCGAGGGGCGCGAGATCGACTTCCGCAACTGCGTGATCCT
GATGACGTCCAACCTCGGCAGCGCGCAGATCGACGAAGCGACGGCAGACAATCCTGAGATTGCACAGGCC
GCGCTGCTCGAGATCATCCGTCCGGCACTCGTCGCGCACTTTCAGCCGGCGCTGCTTGCTCGCTTCCAGA
CGCTGATCTACCGACCGCTCGGTGCGACCGCGCTCGAGTCTATCGTGCGCATGAAGCTTGGCAAAGTCGC
CGATCGCCTGCGCCGTCAGCACGGCATCGAGCTGACCTGCGACGAGTTGCTGATTGAGACGATGGCTGAA
CTGTGTCTCGCTCGTGAATCCGGCGCGCGCAACGTCGACGCATTCCTGAACCAGCGCATCCTCCCGACCG
TGTCGGGCGAGTTGCTCGCACGCATGGCGAGCGGCGCCGTGCCAGCGACGATCACGTTGTCGAGCTCGGC
CGAACGCGGCCTGACGATCGATTTCGTTGACCGCGACGAAGCGGCGCACGCTGAAGCGCACGCACCGCTC
GTTGCATAG