SecReT6
Protein ID: 407712930
SecReT6 ID707
T6SS typei2
Gene symbol-
Locus tagBUPH_01737
StrainBurkholderia phenoliruptrix BR3459a
Repliconchromosome I [GenBank: NC_018695] [Browse all T6SS(s) in this replicon]
Location [Strand]1356578..1358221 [-]
ProductOmpA/MotB domain-containing protein
NoteTagL
UniProt IDK0DNA2, K0DNA2
KEGG IDbpx:BUPH_01737
PDB IDNA
Domain hit(s) vs Pfam OmpA [PF00691], Evalue: 1.90E-19, Aligned region: 225..239
OmpA [PF00691], Evalue: 1.90E-19, Aligned region: 439..535
Protein Sequence: 547 a.a.     [Download]
>gi|407712930|ref|YP_006833495.1| OmpA/MotB domain-containing protein [Burkholderia phenoliruptrix BR3459a]
MRAMLLFAAALALAVVWLVLTVSRGVTWTLTVVIAVVALSLASWFTRRLTRARQQGAQVLAALGAATADI
PVKLRTRMPVVLMTGDGLSALFDRAGDVRHAHVGDGAIWLRVDRAQDLPRLALAVRQWRDGRAPDGVVLS
VVPAQHTGADILVQQLHVVRQAAADASRMLGRQLPGYVAVYQRLTAAPQDLATPQWYGVSTTSRIVDAAR
FEAVIRAAENEAQHAARDRTAAARAAALASIIGWTQRVVIGALSDRHHLAIPWSLFGAGWIDCGPASGPA
NPWARDVEVQTRVMRAPAPASAPPWPLPQPLVQALPRRYWMSPRMAAFAHALALVASAAAVAFWASAKNN
EALLARIGTDLGRYWMIPSAHDTAKRAALQTLVADRDQLDRYARAGIPLPLSFGMYRGAQLMPAVNEAIA
SYAPPPPPPAVVTLDSMSLFDSGHAQLKPGYTRAMVGALEMIKVHPDKRILVAGYTDNVGDPGSNLKLST
ARAQAVRDWLIDASGIPATQFAIQGYGDTRPITSNDTPDGRARNRRVEITLVPDAPK
 
Nucleotide Sequence: 1644 bp     [Download]
>gi|407711772|ref|NC_018695.1|:c1358221-1356578 Burkholderia phenoliruptrix BR3459a chromosome 1, complete sequence
GTGCGCGCGATGCTGCTGTTCGCGGCCGCGTTGGCGCTCGCGGTAGTCTGGCTCGTGTTGACGGTTAGCC
GCGGTGTGACATGGACGCTAACGGTAGTGATCGCAGTGGTCGCGCTCTCACTCGCGTCCTGGTTCACGCG
CCGGCTGACCCGCGCGCGGCAACAGGGCGCACAAGTGCTCGCGGCGCTTGGCGCCGCGACGGCCGATATT
CCGGTGAAACTGCGTACGCGCATGCCCGTCGTCCTCATGACCGGCGACGGTCTATCCGCGCTTTTCGACC
GAGCAGGAGACGTCCGCCATGCGCATGTGGGCGACGGGGCAATCTGGCTGCGCGTCGATCGGGCACAGGA
TCTGCCGCGGCTTGCACTCGCAGTGAGACAGTGGCGCGACGGTCGCGCACCGGACGGGGTGGTGCTGTCA
GTTGTTCCGGCACAGCACACAGGGGCGGACATCCTTGTACAGCAACTGCATGTTGTGCGGCAGGCCGCGG
CGGATGCGTCCCGCATGCTGGGCAGGCAATTACCCGGCTACGTCGCCGTGTATCAGCGGCTCACAGCCGC
TCCTCAAGACCTGGCCACGCCTCAGTGGTATGGCGTTTCAACGACTTCGCGCATCGTCGATGCCGCACGT
TTTGAAGCGGTGATTCGCGCCGCCGAAAACGAAGCGCAGCATGCGGCGCGCGATCGCACGGCAGCCGCGC
GCGCGGCCGCCCTTGCGTCGATCATCGGATGGACACAGCGTGTCGTCATCGGTGCGCTCTCGGATCGGCA
TCACCTTGCCATCCCATGGTCACTCTTCGGTGCCGGCTGGATCGATTGCGGTCCCGCGAGTGGTCCAGCA
AACCCGTGGGCACGCGATGTCGAGGTGCAGACGCGGGTGATGCGCGCACCGGCCCCGGCCTCTGCGCCCC
CTTGGCCGCTGCCTCAACCGCTGGTTCAAGCGCTGCCCCGGCGATACTGGATGTCGCCACGCATGGCAGC
CTTTGCCCATGCGCTTGCGCTCGTAGCATCTGCAGCCGCGGTTGCGTTCTGGGCGTCGGCAAAGAACAAC
GAGGCGCTGCTAGCCCGCATCGGCACGGACCTGGGCCGCTATTGGATGATTCCTTCCGCGCACGATACGG
CCAAGCGCGCGGCACTACAAACACTCGTGGCCGATCGGGATCAACTTGACCGTTATGCGCGCGCCGGCAT
TCCGCTTCCCCTGTCATTCGGCATGTACCGGGGTGCGCAGCTCATGCCGGCTGTGAACGAGGCCATTGCA
TCCTATGCACCACCGCCGCCCCCGCCGGCAGTGGTGACGCTCGACAGCATGTCGCTGTTCGACAGCGGCC
ACGCACAACTCAAGCCCGGCTACACACGTGCAATGGTCGGCGCTCTCGAAATGATCAAGGTGCATCCGGA
TAAACGGATTCTCGTGGCGGGCTATACCGATAACGTAGGCGATCCCGGCAGCAACCTGAAATTATCGACG
GCGCGCGCGCAAGCCGTGCGCGACTGGTTGATCGATGCGTCGGGGATCCCGGCCACACAGTTTGCTATCC
AGGGCTACGGCGACACGCGACCGATCACAAGCAATGACACACCGGACGGCCGCGCCAGGAACCGGCGCGT
CGAAATCACACTGGTACCGGACGCGCCGAAGTGA