SecReT6
Protein ID: 407712931
SecReT6 ID707
T6SS typei2
Gene symbol-
Locus tagBUPH_01738
StrainBurkholderia phenoliruptrix BR3459a
Repliconchromosome I [GenBank: NC_018695] [Browse all T6SS(s) in this replicon]
Location [Strand]1358296..1359039 [-]
Producttype VI secretion system protein ImpK
NoteTssL
UniProt IDK0DPG2
KEGG IDbpx:BUPH_01738
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 9.30E-42, Aligned region: 31..231
Protein Sequence: 247 a.a.     [Download]
>gi|407712931|ref|YP_006833496.1| type VI secretion system protein ImpK [Burkholderia phenoliruptrix BR3459a]
MNALTSSNQEPAALNELSDNSDMPRDDTHESMRALLRDTALLVTTLGTGGAVKEADELRNRCRQLIAHFA
EALQARRYPDDVRREALIAQCGLLDESVLRSLPADMRAGWELQPLQVEQFNLHDAGETVFDRLDARMRES
VPCVDLLECYSAVLGMGFVGRYAREGEAKRTALIAALNARLDRLRPSSERLFVADQAERRLSDWFYRLSP
WAVAALAGIAAVIVWAIWAAALDMQLAHLVSVKGTRP
 
Nucleotide Sequence: 744 bp     [Download]
>gi|407711772|ref|NC_018695.1|:c1359039-1358296 Burkholderia phenoliruptrix BR3459a chromosome 1, complete sequence
ATGAACGCCCTGACTTCCAGCAACCAGGAACCCGCCGCGCTGAACGAACTCTCGGACAACAGTGACATGC
CGCGCGACGACACGCACGAAAGCATGCGCGCCCTGCTGCGAGACACGGCATTGCTGGTGACCACGCTTGG
CACTGGTGGAGCAGTGAAGGAGGCGGACGAACTGCGCAACCGATGCAGGCAACTGATCGCGCATTTTGCG
GAAGCGCTGCAAGCCCGGCGGTATCCAGACGACGTGCGCCGGGAAGCCCTGATTGCCCAGTGCGGGTTGC
TGGACGAATCGGTACTGCGGTCTCTGCCGGCAGATATGCGTGCCGGTTGGGAACTGCAACCGCTGCAGGT
CGAGCAGTTCAACCTGCACGACGCCGGCGAAACCGTGTTCGACCGGCTCGATGCACGTATGCGCGAGAGC
GTACCGTGCGTCGATCTGCTCGAATGCTACTCGGCGGTCCTTGGCATGGGATTCGTCGGCCGCTACGCCC
GCGAGGGCGAGGCAAAACGCACCGCCCTTATCGCGGCGCTCAACGCCAGGCTGGACAGACTTCGACCATC
ATCGGAACGCCTGTTTGTCGCAGACCAAGCGGAGCGGCGCCTGTCCGACTGGTTTTACCGGCTGTCTCCG
TGGGCCGTTGCGGCTCTGGCAGGTATTGCTGCAGTGATCGTCTGGGCGATATGGGCGGCGGCACTCGACA
TGCAACTTGCCCATCTAGTGTCGGTGAAAGGCACCCGCCCGTGA