SecReT6
Protein ID: 407712932
SecReT6 ID707
T6SS typei2
Gene symbol-
Locus tagBUPH_01739
StrainBurkholderia phenoliruptrix BR3459a
Repliconchromosome I [GenBank: NC_018695] [Browse all T6SS(s) in this replicon]
Location [Strand]1359036..1360367 [-]
Producttype VI secretion system protein ImpJ
NoteTssK
UniProt IDK0DKJ8
KEGG IDbpx:BUPH_01739
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 5.70E-119, Aligned region: 7..440
Protein Sequence: 443 a.a.     [Download]
>gi|407712932|ref|YP_006833497.1| type VI secretion system protein ImpJ [Burkholderia phenoliruptrix BR3459a]
MILTQQHFQQQDRWAGFAMQQFATAVLTEPWGTLGVEVDEEALATGRLKLTRLKLRFPDGTPIDTALADA
LPAGRDLTHGLPADRQSITVLAALALPDANGNNCRFDEATLARPRRSYREFVKVADLNGVTETEIAAERH
AVRLLFDFESHADDTACAIVRLTRSGSGSGGGQFRVDHAFVPPCLTLGSHPLHLERIARLADILQAKSLA
LGARRSERMEQIVEYGVADVQLFWLLHCIHSAWPQLRLFLTHPGRPPEHLYATLAQLASALMTFSTGAQL
ADIPTYDHVCADEVFAKLESMIRDLLDAIIPSRVVSIGLTRKTPTTWTGQFLDERIAGDAADWYLSVNAP
MAAFELVEQFPRLCKIGAPDDVGHIINSALLGIPLKAVQRVPAAIPVRLDNQYFALDSSSAAHARMLAAR
ACQIYLPASIPDAALQLYAVLRT
 
Nucleotide Sequence: 1332 bp     [Download]
>gi|407711772|ref|NC_018695.1|:c1360367-1359036 Burkholderia phenoliruptrix BR3459a chromosome 1, complete sequence
TTGATCCTCACGCAGCAGCACTTTCAGCAACAGGACCGATGGGCCGGATTCGCGATGCAGCAGTTCGCCA
CTGCGGTGCTCACGGAGCCATGGGGCACCCTGGGCGTCGAGGTCGACGAAGAGGCGCTCGCGACCGGCCG
TCTCAAGCTCACGCGGCTGAAGCTTCGCTTTCCCGATGGCACGCCGATCGACACCGCACTGGCCGACGCC
CTCCCGGCGGGGCGCGATCTGACGCATGGCCTTCCGGCTGACCGGCAAAGCATCACAGTGCTCGCGGCGC
TCGCTCTACCCGATGCGAACGGCAACAACTGCCGCTTCGATGAAGCCACGCTGGCGCGTCCGCGTCGCTC
ATACCGTGAGTTCGTGAAGGTGGCTGACCTCAACGGGGTGACTGAGACAGAGATCGCCGCGGAACGTCAT
GCCGTGCGCCTGCTGTTCGACTTCGAGTCGCATGCGGACGACACGGCGTGCGCGATCGTGCGGCTTACTC
GCAGCGGCAGCGGCTCGGGCGGCGGTCAGTTCCGCGTCGATCATGCATTCGTCCCTCCCTGCCTGACGCT
TGGCAGTCACCCGCTTCACCTCGAACGGATCGCCCGGCTCGCTGACATCCTGCAGGCGAAAAGCCTCGCG
CTCGGCGCTCGGCGCAGCGAGCGCATGGAGCAGATCGTGGAATACGGCGTGGCCGACGTACAGCTTTTCT
GGCTACTGCACTGTATCCATTCTGCCTGGCCGCAACTGCGGCTCTTTCTCACCCACCCCGGCCGGCCGCC
GGAGCATCTGTACGCGACACTCGCCCAGTTGGCGAGCGCACTCATGACGTTCTCGACCGGGGCGCAGCTG
GCTGACATTCCCACGTACGACCATGTCTGCGCAGACGAAGTGTTTGCGAAACTCGAATCGATGATCCGCG
ACCTGCTCGACGCGATCATTCCGTCACGCGTCGTATCTATCGGGCTCACGCGCAAGACGCCGACAACATG
GACTGGGCAGTTCCTCGACGAGCGTATCGCGGGAGATGCCGCTGACTGGTATCTGTCGGTGAACGCGCCA
ATGGCCGCGTTCGAGCTCGTCGAGCAGTTTCCGCGGCTGTGCAAGATTGGCGCACCCGACGACGTTGGGC
ACATCATCAATTCCGCGCTGCTGGGTATTCCGCTGAAGGCGGTGCAGCGAGTGCCCGCCGCAATTCCGGT
ACGCCTCGACAACCAATACTTCGCGCTCGATTCATCCAGCGCCGCGCATGCCAGGATGCTTGCCGCGCGT
GCCTGTCAGATCTACCTCCCGGCGTCGATACCCGATGCCGCGCTTCAACTCTACGCGGTGCTGCGTACAT
GA