SecReT6
Protein ID: 407712933
SecReT6 ID707
T6SS typei2
Gene symbol-
Locus tagBUPH_01740
StrainBurkholderia phenoliruptrix BR3459a
Repliconchromosome I [GenBank: NC_018695] [Browse all T6SS(s) in this replicon]
Location [Strand]1361032..1361463 [+]
Producttype VI secretion system protein ImpB
NoteTssB
UniProt IDK0DH47
KEGG IDbpx:BUPH_01740
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 1.30E-43, Aligned region: 1..130
Protein Sequence: 143 a.a.     [Download]
>gi|407712933|ref|YP_006833498.1| type VI secretion system protein ImpB [Burkholderia phenoliruptrix BR3459a]
MELPLKLLVAGDFSAGREQAPLAERKKVNIDKNNFDAVLADYAPDLKLAAENTLAADGSELPVTLSFRSM
KDFEPEQVARQIPQMQAMLAMRNLLRDLKSNLLDNGTFRREFEKILKDRRLSDKLRGELAQIATAATQQE
GHA
 
Nucleotide Sequence: 432 bp     [Download]
>gi|407711772|ref|NC_018695.1|:1361032-1361463 Burkholderia phenoliruptrix BR3459a chromosome 1, complete sequence
GTGGAATTGCCCCTCAAACTGCTTGTTGCGGGGGACTTCAGTGCAGGCCGTGAACAGGCGCCGCTCGCCG
AGCGCAAGAAGGTGAACATTGACAAGAACAACTTCGATGCTGTTCTGGCCGACTACGCGCCAGACCTGAA
GCTCGCGGCGGAGAACACGTTGGCCGCTGATGGTTCAGAACTGCCCGTCACTCTCTCCTTTCGCTCGATG
AAGGACTTCGAGCCGGAACAGGTGGCGCGCCAGATTCCGCAAATGCAGGCCATGCTTGCAATGCGCAATT
TACTGCGCGATTTGAAAAGCAACCTGCTCGACAACGGCACTTTTCGTCGGGAATTCGAAAAAATTCTGAA
GGACAGGCGTCTGTCAGACAAGTTGCGCGGCGAGCTTGCCCAGATAGCAACCGCGGCGACGCAACAGGAA
GGCCATGCCTGA