SecReT6
Protein ID: 407712934
SecReT6 ID707
T6SS typei2
Gene symbol-
Locus tagBUPH_01741
StrainBurkholderia phenoliruptrix BR3459a
Repliconchromosome I [GenBank: NC_018695] [Browse all T6SS(s) in this replicon]
Location [Strand]1361536..1363068 [+]
Producttype VI secretion system protein ImpC
NoteTssC
UniProt IDK0DKP7
KEGG IDbpx:BUPH_01741
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 2.00E-175, Aligned region: 85..506
Protein Sequence: 510 a.a.     [Download]
>gi|407712934|ref|YP_006833499.1| type VI secretion system protein ImpC [Burkholderia phenoliruptrix BR3459a]
MKQNEARQGAAETLVLENDSVYASLCNKINLNIVAEARPLEAFRDNDILAEASADERVARGMDALLNLVA
NESKPVDRLDKSLLDFYIGQLDRQIGRQLDAVMHTPEFQALEGRWRGLKMLVSRTDFRRNAKIEVLDVSK
DALQLDFEDTPELVQSGLYRLAYIEEYDTPGGQPISAMISDFEFTNSPMDIALLRNISKVAAAAHMPFIG
SVGAAFFGKKSMEEVAAIQDIGNYFDRAEYIKWKSFRDTDDARYVGLTMPRVLGRLPYGRDTVPVRAFNY
EEGVRGPDHDKYLWVNASFAFAANMTRSFVNNGWCVQIRGPQAGGKVEDLPVHLYDLGTGAQPKIPTEVL
IPETREFEFANLGFIPLSFYKNHDFACFFSANSTQKPALYDTKEATANSRINARLPYIFLLSRIAHYLKL
IQRENIGTTKDRRLLEIELNNWIKGLVTEMKDPGDELQASHPLREAKVTVEDIEDNPGFFRIKLFIIPHF
QVEGMDIGLSLVSQMPKAKS
 
Nucleotide Sequence: 1533 bp     [Download]
>gi|407711772|ref|NC_018695.1|:1361536-1363068 Burkholderia phenoliruptrix BR3459a chromosome 1, complete sequence
ATGAAACAGAACGAAGCCCGTCAGGGTGCAGCGGAAACACTCGTGCTCGAGAACGACAGTGTGTACGCCT
CGCTTTGCAACAAGATCAACCTTAACATCGTCGCCGAGGCCCGCCCGCTGGAAGCGTTTCGCGACAATGA
CATATTGGCCGAGGCATCGGCCGACGAACGCGTTGCCCGCGGCATGGACGCGCTGCTGAATCTGGTCGCG
AACGAAAGCAAGCCGGTTGACCGGCTCGACAAATCGCTGCTTGATTTCTACATCGGCCAGCTCGATCGGC
AGATCGGTCGTCAGCTCGACGCCGTGATGCACACGCCGGAATTCCAGGCCCTCGAAGGCCGGTGGCGCGG
TCTGAAGATGCTCGTGTCGCGTACGGACTTCCGCAGGAACGCGAAGATCGAAGTGCTCGACGTATCGAAG
GACGCATTGCAGCTGGACTTCGAGGACACGCCCGAGCTGGTTCAGAGCGGCCTGTACCGCCTCGCCTATA
TCGAGGAATATGACACGCCGGGCGGGCAGCCGATCAGCGCAATGATCAGCGATTTCGAGTTCACAAACTC
GCCGATGGACATTGCACTGCTTCGCAACATCTCGAAGGTTGCTGCAGCCGCCCACATGCCGTTTATAGGT
TCGGTGGGCGCCGCGTTTTTCGGCAAGAAATCGATGGAAGAAGTGGCCGCCATTCAGGATATTGGCAACT
ATTTCGACCGCGCCGAGTACATCAAGTGGAAGAGCTTCCGCGATACGGACGATGCCCGCTACGTCGGGCT
GACGATGCCGCGGGTGCTTGGGCGCCTGCCGTACGGTAGGGATACCGTGCCAGTGCGCGCGTTCAACTAT
GAGGAGGGGGTGAGAGGTCCCGACCACGACAAATATCTGTGGGTGAATGCATCGTTTGCGTTTGCAGCCA
ACATGACGCGCAGCTTTGTGAACAATGGCTGGTGCGTGCAGATCCGCGGTCCCCAGGCCGGCGGCAAGGT
GGAAGATCTGCCGGTGCACCTGTATGACCTTGGCACCGGCGCTCAGCCGAAGATCCCGACCGAAGTGCTG
ATTCCCGAGACCCGCGAGTTCGAATTCGCGAATCTGGGCTTCATCCCGCTGTCGTTCTACAAGAATCATG
ATTTTGCGTGTTTCTTCTCAGCCAACTCCACGCAAAAACCAGCACTGTACGACACGAAAGAGGCGACGGC
GAACAGCCGCATCAATGCGCGCCTGCCGTACATCTTCCTGCTCTCGCGCATCGCGCACTATCTCAAGCTG
ATCCAGCGCGAGAACATCGGCACGACCAAGGACCGGCGCCTGCTCGAGATCGAGCTGAACAACTGGATCA
AGGGTCTCGTGACCGAGATGAAGGACCCGGGCGATGAGTTGCAGGCGTCGCACCCGCTGCGTGAGGCGAA
GGTGACGGTGGAGGATATCGAGGACAACCCGGGCTTCTTCCGCATCAAGCTTTTCATCATTCCGCACTTC
CAGGTCGAGGGCATGGACATCGGGCTGTCGTTGGTGTCCCAGATGCCCAAGGCCAAAAGCTGA