SecReT6
Protein ID: 407712935
SecReT6 ID707
T6SS typei2
Gene symbol-
Locus tagBUPH_01742
StrainBurkholderia phenoliruptrix BR3459a
Repliconchromosome I [GenBank: NC_018695] [Browse all T6SS(s) in this replicon]
Location [Strand]1363152..1365491 [+]
Productrhs element Vgr protein
NoteTssI
UniProt IDK0DNA4
KEGG IDbpx:BUPH_01742
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 7.60E-55, Aligned region: 30..350
DUF2345 [PF10106], Evalue: 6.20E-36, Aligned region: 532..546
DUF2345 [PF10106], Evalue: 6.20E-36, Aligned region: 604..744
T6SS_Vgr [PF13296], Evalue: 1.40E-27, Aligned region: 480..585
T6SS_Vgr [PF13296], Evalue: 1.40E-27, Aligned region: 607..646
Phage_base_V [PF04717], Evalue: 1.80E-12, Aligned region: 108..155
Phage_base_V [PF04717], Evalue: 1.80E-12, Aligned region: 406..474
Protein Sequence: 779 a.a.     [Download]
>gi|407712935|ref|YP_006833500.1| rhs element Vgr protein [Burkholderia phenoliruptrix BR3459a]
MSSIVPLQAYELKLAPHPAPFSVLRFSGRDAVSELYRYDIEFTSPVSGIPMEQVVGRPAKFIIAPVDPEM
DYLRRMFGENAEQFSRMSPAYTIHGVITEFDEYATSADQTHYRVRLEPKLADLNRGVTSRLFQKQSVKEI
VTDTLRHEGYRAGVDFEFRLRHQYRRHEYVTQYHETTFGFIQRLCAQEGIWFRWEQKKDRAVLVFGDDLD
AYARKQRTVAYRRDSGLESSGTDAIKTLEKRTRRVPEAVRLHDYNHREAGVSLLVDENAARDDRTTNGID
YRWGEHYQTPDEGKGVARLRHEEYLAQQITFRGTGNPFWLEAGEVMRLDPNPADAKHGIFITSVESSGGR
SESYWVSFEGIPSDRVWRTPMASIERPSIDGILPARITSPGNYKYAYLTEQGWYVIRLPFDLDEWSPGGT
SRPVRFAKPYSGDNYGHHFPLIDGAEVAIVFTGGDPDRPVIIGAMHDSLHPDLVNNLNHTRNIVRTAAQN
EMRMEDKEGVEHIHLSTPHQTSELNLGHMVDENRKERGQGAELRTDGRVAVRGAKGVLISAELQAAATGE
QCAMQNADDTFRLSEEILKTLNHSAGVAKALLAEVERQRALVDQNLSQLQKCVVVASAPDGMGLSSGSHF
QLAARKQLFMTAGDGLDVGVMKRIAIAAGEAISLFAAKLGIRIFAAQGKVQVHSQSDELELMALKKVTMS
SSTDEVTVTASKGIILGDGAGAYIKIASGRIELASPSGQIDVKGNLEVDESAGGNFTFPSWVTSAPKDVK
SNLGFGFSE
 
Nucleotide Sequence: 2340 bp     [Download]
>gi|407711772|ref|NC_018695.1|:1363152-1365491 Burkholderia phenoliruptrix BR3459a chromosome 1, complete sequence
ATGTCGTCGATCGTGCCTCTACAGGCTTACGAGTTGAAGCTGGCGCCGCATCCGGCGCCCTTTTCCGTGC
TCAGATTCAGCGGTCGCGATGCGGTGAGCGAGTTGTACCGGTACGACATCGAATTCACCAGCCCCGTGTC
CGGCATCCCGATGGAGCAGGTGGTCGGTCGGCCCGCAAAGTTCATCATCGCGCCGGTCGATCCGGAGATG
GACTATCTGCGCAGGATGTTCGGCGAGAACGCGGAGCAGTTCAGCCGGATGTCTCCCGCATACACGATCC
ATGGCGTGATCACGGAGTTCGATGAGTATGCGACGTCAGCCGATCAGACACACTATCGGGTGCGGCTCGA
GCCGAAGCTCGCCGACCTGAACCGGGGCGTCACGAGCCGCCTGTTCCAGAAGCAGTCGGTCAAGGAAATC
GTGACCGACACGCTGCGCCATGAGGGCTACCGCGCAGGTGTGGACTTCGAGTTCCGGTTGCGCCACCAGT
ACAGGCGGCACGAGTACGTCACGCAATATCACGAGACAACGTTTGGCTTCATCCAGCGCCTTTGTGCGCA
GGAGGGGATCTGGTTCCGCTGGGAGCAGAAAAAGGATCGCGCGGTCCTCGTGTTCGGGGACGATCTCGAT
GCCTACGCGCGCAAACAGCGCACGGTGGCGTACCGGCGCGACTCAGGGCTCGAGAGTTCCGGCACCGATG
CGATCAAGACGCTCGAGAAGCGGACGCGGCGTGTGCCCGAGGCGGTGCGGCTGCACGACTACAACCATCG
CGAGGCGGGCGTCTCGCTGCTCGTTGATGAAAATGCCGCGCGCGACGACAGGACAACGAACGGGATCGAT
TATCGGTGGGGCGAGCATTACCAGACGCCCGACGAGGGCAAGGGCGTGGCACGACTGCGCCACGAGGAAT
ATCTGGCGCAGCAGATCACGTTCAGGGGGACCGGCAACCCGTTCTGGCTCGAAGCCGGCGAAGTCATGCG
CCTGGACCCGAATCCGGCCGACGCGAAACACGGGATCTTCATCACATCGGTCGAATCGAGCGGTGGGCGC
AGCGAGTCGTACTGGGTGAGCTTCGAGGGAATTCCGTCGGACCGGGTGTGGCGCACGCCGATGGCGTCGA
TCGAGCGACCATCCATCGACGGCATCCTGCCCGCCCGCATTACGTCACCGGGCAATTACAAATACGCATA
CCTGACGGAGCAGGGCTGGTATGTGATCAGGCTGCCGTTCGATCTCGACGAGTGGAGTCCGGGCGGGACG
AGCCGGCCGGTGCGGTTCGCGAAGCCGTACAGCGGGGACAACTACGGACATCACTTCCCGCTGATCGACG
GGGCCGAGGTGGCGATCGTCTTTACGGGCGGGGATCCGGATCGGCCCGTGATTATTGGCGCGATGCATGA
CAGTCTGCATCCGGATCTCGTCAATAACCTCAACCACACGCGCAACATCGTTCGCACAGCTGCTCAGAAC
GAGATGCGGATGGAGGACAAGGAAGGTGTCGAGCATATCCACCTGAGCACGCCGCATCAGACCAGTGAGC
TCAACCTGGGACATATGGTCGATGAGAACCGGAAGGAGCGTGGGCAGGGTGCAGAGTTGCGGACGGACGG
GCGTGTTGCAGTGCGGGGCGCAAAAGGCGTACTCATATCCGCGGAACTCCAAGCCGCAGCCACGGGCGAG
CAATGCGCGATGCAGAATGCTGACGACACATTCCGGCTATCCGAAGAGATCCTCAAGACGCTCAACCACA
GCGCCGGCGTCGCGAAGGCTCTGCTCGCCGAAGTCGAAAGACAACGGGCCCTTGTCGACCAAAACCTGTC
CCAACTGCAGAAGTGCGTGGTCGTTGCAAGTGCACCTGACGGCATGGGGCTGTCGAGCGGTAGTCACTTT
CAGCTTGCAGCGCGCAAACAACTTTTCATGACCGCAGGCGATGGTCTTGACGTCGGCGTCATGAAGCGCA
TAGCGATAGCTGCTGGCGAAGCGATTTCGCTCTTTGCTGCAAAGCTCGGTATCCGCATTTTCGCCGCACA
GGGCAAGGTGCAAGTGCATTCTCAGAGCGATGAACTGGAGTTGATGGCGCTCAAGAAGGTCACCATGAGT
TCATCGACTGATGAGGTAACCGTCACGGCTTCAAAGGGCATCATCTTGGGTGACGGTGCCGGAGCCTACA
TCAAGATTGCCAGCGGACGGATCGAGTTGGCGAGCCCCAGTGGCCAGATCGACGTAAAGGGTAACCTGGA
AGTGGACGAGTCAGCCGGAGGCAACTTCACATTCCCAAGCTGGGTAACGTCCGCGCCGAAGGACGTGAAG
AGCAATCTGGGTTTCGGTTTTTCTGAATAG